KEGG   Meleagris gallopavo (turkey): 100546053Help
Entry
100546053         CDS       T01523                                 

Gene name
CACNA2D3
Definition
calcium channel, voltage-dependent, alpha 2/delta subunit 3
Orthology
K04860  
voltage-dependent calcium channel alpha-2/delta-3
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
MAPK signaling pathway
Cardiac muscle contraction
Adrenergic signaling in cardiomyocytes
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway [PATH:mgp04010]
Organismal Systems; Circulatory system; Cardiac muscle contraction [PATH:mgp04260]
Organismal Systems; Circulatory system; Adrenergic signaling in cardiomyocytes [PATH:mgp04261]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
14
AA seq 1069 aa AA seqDB search
FNTALVDVVGSEQQIPLSVVKLWASAFGGEIKSIAAKYSGSQLLQKKYKEYEKDVAIEEI
DGLQLVKKLAKNMEEMFHKKSEAVRRLVEAAEDAYLKHEFDADLQYEYFNAVLINERDEE
GNYLELGKEFILVPNDHFNNLPVNISLSDVQVPTNMYNKDPAIVNGVYWSESLNKVFVDN
FDRDPSLIWQYFGSAKGFFRQYPGIKWEPDENGVIAFDCRNRKWYIQAATSPKDVVILVD
VSGSMKGLRLTIAKQTVSSILDTLGDDDFFNIIAYNEELHYVEPCLNGTLVQADRTNKEH
FREHLDKLFAKGIGMLDIALNEAFNMLNEFNHTGQGSICSQAIMLITDGAVDTYDTIFAK
YNWPDRKVRIFTYLIGREAAFADNLKWMACANKGFFTQISTLADVQENVMEYLHVLSRPK
VIDQEHDVVWTEAYIDSTLPQAQKLADDQGLVLMTTVAMPVFSKQNETRSKGILLGVVGT
DVPVKELLKAIPKYKLGIHGYAFAITNNGYILTHPELRPLYEEGKKRRKPNYSSVDLSEV
EWEDRDDVLRNAMVNRKTGKFSMEVKKTVDKGKRVLVMTNDYYYTDIKGTPFSLGVALSR
GHGKYFFRGNVTVEEGLHDLEHPDVSLADEWSYCNTDLHPEHRQMTQLEAIKRYLTGKEP
LLQCDKELIQEVLFDAVVSAPIEAYWTSLALNKSENSDKGVEVAFLGTRTGLSRINLFVG
PEQLTNQDFLTAEDKENIFNADHFPLWYRRAAEQIPGSFVYSIPFSTETANKSNVVTAST
AIQLLDDRKSPVVAAVGIQMKLEFFQRKFWTASRQCASLDGRCAISCDDEAINCYLIDNN
GFILVSEDYGQTGNFFGEIEGAVMNKLLTMGSFKRITLYDYQAMCRTNKESSDSAHSLLD
PYNAFFAAVKWIMTELVLFLVEFNLCSWWHSDLTAKAQRLKQTLEPCDTEYPAFVSERTI
KETTGNIACDDCFKSFVIQQIPSSNLFMVVVDNECFCDSVPPITMAPIEIRYNESLKCER
LKSQKIRRRPESCHGYHPEENARECGGVPGLSAKPPFVLLPLLLTIFSR
NT seq 3212 nt NT seq  +upstreamnt  +downstreamnt
cttttaacacagccttagtggatgtggttggatcggagcagcagatccccctgtctgttg
tgaagctctgggcctcagcgtttggtggggagatcaaatctattgcagccaagtactcgg
gttcccagctcctgcagaagaaatacaaagaatatgagaaagacgttgcaatcgaagaaa
tcgatggccttcagcttgtgaaaaagttagcaaagaatatggaagaaatgtttcataaaa
agtccgaagctgtgcggcgtcttgttgaagctgcagaagatgcttacctgaaacatgagt
ttgatgctgatttacagtatgagtacttcaatgctgtgcttataaatgaaagagatgaag
aagggaactatctggagctgggaaaggagttcattctagtgccaaatgaccacttcaata
acttgcctgtaaatatcagtctgagtgacgtccaagtaccaaccaatatgtataataaag
atccagccattgtaaatggagtttattggtcagaatccttaaataaggtgtttgttgata
attttgatcgtgacccttctctcatctggcagtactttggaagtgcaaaaggatttttca
gacagtatccaggaattaaatgggaacctgatgagaatggagttattgcatttgactgca
gaaatagaaaatggtacatccaagcagcaacttctccaaaagatgtggtaattttagtag
atgtcagtggcagtatgaaaggacttcgcttgactatcgctaaacagacagtttcatcta
ttttggatacccttggagatgacgacttcttcaatataattgcttataatgaagaacttc
actatgtagaaccgtgtctgaacggaacattggttcaagcagacagaaccaacaaagagc
attttagggaacaccttgacaagctttttgcaaaaggaattggaatgctggacattgctt
taaatgaagctttcaacatgctcaatgaattcaatcacacaggacaaggaagtatttgca
gccaagccataatgttgattactgatggagctgtggacacatacgacacaatatttgcaa
aatataattggccagacagaaaagttcgtatttttacatatctgattggaagagaagctg
cttttgctgataacttgaagtggatggcctgtgctaacaaagggttttttactcagatct
ctaccttagctgatgttcaagagaatgtcatggaatacctccatgttcttagccgaccaa
aagttattgaccaagagcatgacgtggtatggacagaagcatatattgacagcactctcc
ctcaggctcaaaagcttgctgacgatcagggattggtgttgatgacaactgttgccatgc
cggtatttagtaagcaaaatgagactagatcaaaagggattctcctgggagtagttggca
cagacgtcccagttaaagaacttctaaaagctattccaaaatacaagttaggtattcatg
gatatgcttttgcaattacaaacaatggatatattttgactcatccagaacttaggcctt
tgtatgaagaagggaagaaacgaagaaagcccaactacagtagtgtggatctttctgagg
ttgagtgggaagacagagatgatgtgcttcgaaatgcaatggtgaatcgcaaaacaggaa
aattctccatggaagtgaagaagacggtggacaaagggaaacgggtattggtgatgacaa
atgactactattatacagacatcaagggtactccattcagtttaggtgtggctctctcta
gaggacatggaaaatatttcttcagagggaatgtaactgtggaagaaggtttacatgatt
tagaacaccctgatgtatctttagcagatgaatggtcctattgcaacactgacttgcatc
ctgaacaccgtcaaatgactcagttagaagcaattaaacgctacctcacaggaaaagagc
cattgctccaatgtgataaagaattgatccaggaagttctgtttgatgcagtggtgagtg
caccaattgaagcttattggaccagtttagcactaaataaatcagaaaattctgacaagg
gagtagaagttgccttccttggaacacggactggactatctcgtatcaacctgtttgtgg
gtccagaacagcttactaatcaagatttcctgacagctgaagacaaggaaaacattttta
atgctgatcattttccactctggtacagaagagctgctgagcaaatacccgggagctttg
tctattcaatcccatttagtacagaaacagcaaataaaagcaatgtagtgacagccagta
ctgccattcagcttttggatgacagaaaatctccagtcgttgcagctgtaggtatccaga
tgaaacttgaatttttccagcgtaaattttggacagcaagcagacagtgtgcatctcttg
atggcagatgtgcaataagttgtgatgatgaagcaatcaactgttacctaatagacaaca
atggatttattctagtgtctgaagactatgggcagactggtaacttttttggggagattg
aaggggctgtgatgaacaaattactaacaatgggctcctttaagagaattacactttatg
actaccaggccatgtgtagaacaaacaaagagagtagcgacagtgcccatagcttactgg
acccttataatgccttctttgctgcagtaaaatggattatgacagagcttgtcttgttcc
ttgtggagtttaatctatgcagttggtggcactctgatctaacagcaaaagcgcagaggt
tgaaacaaaccctagagccctgtgatactgaatatccagcttttgtttccgaacgcacta
taaaggagaccacggggaatattgcttgcgatgactgtttcaagtcctttgtaatccagc
aaatcccaagcagcaatctttttatggtggtagtagataacgaatgcttctgtgattcag
tcccaccaattaccatggcacctatagaaataagatataatgaatcccttaagtgtgagc
gtttaaaatctcagaagataagaagacgtccagaatcttgccatggatatcaccctgaag
aaaatgcaagagaatgtggtggtgtcccaggtcttagcgctaagcctccttttgttcttc
ttcctctgctattgacaattttctcaaggtga

DBGET integrated database retrieval system