KEGG   Meleagris gallopavo (turkey): 100546053Help
Entry
100546053         CDS       T01523                                 

Gene name
CACNA2D3
Definition
(RefSeq) calcium channel, voltage-dependent, alpha 2/delta subunit 3
  KO
K04860  
voltage-dependent calcium channel alpha-2/delta-3
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
MAPK signaling pathway
Cardiac muscle contraction
Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:mgp00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    100546053 (CACNA2D3)
 Organismal Systems
  Circulatory system
   04260 Cardiac muscle contraction
    100546053 (CACNA2D3)
   04261 Adrenergic signaling in cardiomyocytes
    100546053 (CACNA2D3)
Ion channels [BR:mgp04040]
 Voltage-gated cation channels
  Ca2+ channel, CACN alpha-2 delta
   100546053 (CACNA2D3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
14
AA seq 1084 aa AA seqDB search
MLENLNLLRTFGGFFFIFWTAFNTALVDVVGSEQQIPLSVVKLWASAFGGEIKSIAAKYS
GSQLLQKKYKEYEKDVAIEEIDGLQLVKKLAKNMEEMFHKKSEAVRRLVEAAEDAYLKHE
FDADLQYEYFNAVLINERDEEGNYLELGKEFILVPNDHFNNLPVNISLSDVQVPTNMYNK
DPAIVNGVYWSESLNKVFVDNFDRDPSLIWQYFGSAKGFFRQYPGIKWEPDENGVIAFDC
RNRKWYIQAATSPKDVVILVDVSGSMKGLRLTIAKQTVSSILDTLGDDDFFNIIAYNEEL
HYVEPCLNGTLVQADRTNKEHFREHLDKLFAKGIGMLDIALNEAFNMLNEFNHTGQGSIC
SQAIMLITDGAVDTYDTIFAKYNWPDRKVRIFTYLIGREAAFADNLKWMACANKGFFTQI
STLADVQENVMEYLHVLSRPKVIDQEHDVVWTEAYIDSTLADDQGLVLMTTVAMPVFSKQ
NETRSKGILLGVVGTDVPVKELLKAIPKYKLGIHGYAFAITNNGYILTHPELRPLYEEGK
KRRKPNYSSVDLSEVEWEDRDDVLRNAMVNRKTGKFSMEVKKTVDKGKRVLVMTNDYYYT
DIKGTPFSLGVALSRGHGKYFFRGNVTVEEGLHDLEHPDVSLADEWSYCNTDLHPEHRQM
TQLEAIKRYLTGKEPLLQCDKELIQEVLFDAVVSAPIEAYWTSLALNKSENSDKGVEVAF
LGTRTGLSRINLFVGPEQLTNQDFLTAEDKENIFNADHFPLWYRRAAEQIPGSFVYSIPF
STETANKSNVVTASTAIQLLDDRKSPVVAAVGIQMKLEFFQRKFWTASRQCASLDGRCAI
SCDDEAINCYLIDNNGFILVSEDYGQTGNFFGEIEGAVMNKLLTMGSFKRITLYDYQAMC
RTNKESSDSAHSLLDPYNAFFAAVKWIMTELVLFLVEFNLCSWWHSDLTAKAQRLKQTLE
PCDTEYPAFVSERTIKETTGNIACDDCFKSFVIQQIPSSNLFMVVVDNECFCDSVPPITM
APIEIRYNESLKCERLKSQKIRRRPESCHGYHPEENARECGGVPGLSAKPPFVLLPLLLT
IFSR
NT seq 3255 nt NT seq  +upstreamnt  +downstreamnt
atgctagaaaatctgaatcttcttcggacttttgggggttttttctttatcttctggaca
gcttttaacacagccttagtggatgtggttggatcggagcagcagatccccctgtctgtt
gtgaagctctgggcctcagcgtttggtggggagatcaaatctattgcagccaagtactcg
ggttcccagctcctgcagaagaaatacaaagaatatgagaaagacgttgcaatcgaagaa
atcgatggccttcagcttgtgaaaaagttagcaaagaatatggaagaaatgtttcataaa
aagtccgaagctgtgcggcgtcttgttgaagctgcagaagatgcttacctgaaacatgag
tttgatgctgatttacagtatgagtacttcaatgctgtgcttataaatgaaagagatgaa
gaagggaactatctggagctgggaaaggagttcattctagtgccaaatgaccacttcaat
aacttgcctgtaaatatcagtctgagtgacgtccaagtaccaaccaatatgtataataaa
gatccagccattgtaaatggagtttattggtcagaatccttaaataaggtgtttgttgat
aattttgatcgtgacccttctctcatctggcagtacttcggaagtgcaaaaggatttttc
agacagtatccaggaattaaatgggaacctgatgagaatggagttattgcatttgactgc
agaaatagaaaatggtacatccaagcagcaacttctccaaaagatgtggtaattttagta
gatgtcagtggcagtatgaaaggacttcgcttgactatcgctaaacagacagtttcatct
attttggatacccttggagatgacgacttcttcaatataattgcttataatgaagaactt
cactatgtagaaccgtgtctgaacggaacattggttcaagcagacagaaccaacaaagag
cattttagggaacaccttgacaagctttttgcaaaaggaattggaatgctggacattgct
ttaaatgaagctttcaacatgctcaatgaattcaatcacacaggacaaggaagtatttgc
agccaagccataatgttgattactgatggagctgtggacacatacgacacaatatttgca
aaatataattggccagacagaaaagttcgtatttttacatatctgattggaagagaagct
gcttttgctgataacttgaagtggatggcctgtgctaacaaagggttttttactcagatc
tctaccttagctgatgttcaagagaatgtcatggaatacctccatgttcttagccgacca
aaagttattgaccaagagcatgacgtggtatggacagaagcatatattgacagcactctt
gctgacgatcagggattggtgttgatgacaactgttgccatgccggtatttagtaagcaa
aatgagactagatcaaaagggattctcctgggagtagttggcacagacgtcccagttaaa
gaacttctaaaagctattccaaaatacaagttaggtattcatggatatgcttttgcaatt
acaaacaatggatatattttgactcatccagaacttaggcctttgtatgaagaagggaag
aaacgaagaaagcccaactacagtagtgtggatctttctgaggttgagtgggaagacaga
gatgatgtgcttcgaaatgcaatggtgaatcgcaaaacaggaaaattctccatggaagtg
aagaagacggtggacaaagggaaacgggtattggtgatgacaaatgactactattataca
gacatcaagggtactccattcagtttaggtgtggctctctctagaggacatggaaaatat
ttcttcagagggaatgtaactgtggaagaaggtttacatgatttagaacaccctgatgta
tctttagcagatgaatggtcctattgcaacactgacttgcatcctgaacaccgtcaaatg
actcagttagaagcaattaaacgctacctcacaggaaaagagccattgctccaatgtgat
aaagaattgatccaggaagttctgtttgatgcagtggtgagtgcaccaattgaagcttat
tggaccagtttagcactaaataaatcagaaaattctgacaagggagtagaagttgccttc
cttggaacacggactggactatctcgtatcaacctgtttgtgggtccagaacagcttact
aatcaagatttcctgacagctgaagacaaggaaaacatttttaatgctgatcattttcca
ctctggtacagaagagctgctgagcaaatacccgggagctttgtctattcaatcccattt
agtacagaaacagcaaataaaagcaatgtagtgacagccagtactgccattcagcttttg
gatgacagaaaatctccagtcgttgcagctgtaggtatccagatgaaacttgaatttttc
cagcgtaaattttggacagcaagcagacagtgtgcatctcttgatggcagatgtgcaata
agttgtgatgatgaagcaatcaactgttacctaatagacaacaatggatttattctagtg
tctgaagactatgggcagactggtaacttttttggggagattgaaggggctgtgatgaac
aaattactaacaatgggctcctttaagagaattacactttatgactaccaggccatgtgt
agaacaaacaaagagagtagcgacagtgcccatagcttactggacccttataatgccttc
tttgctgcagtaaaatggattatgacagagcttgtcttgttccttgtggagtttaatcta
tgcagttggtggcactctgatctaacagcaaaagcgcagaggttgaaacaaaccctagag
ccctgtgatactgaatatccagcttttgtttccgaacgcactataaaggagaccacgggg
aatattgcttgcgatgactgtttcaagtcctttgtaatccagcaaatcccaagcagcaat
ctttttatggtggtagtagataacgaatgcttctgtgattcagtcccaccaattaccatg
gcacctatagaaataagatataatgaatcccttaagtgtgagcgtttaaaatctcagaag
ataagaagacgtccagaatcttgccatggatatcaccctgaagaaaatgcaagagaatgt
ggtggtgtcccaggtcttagcgctaagcctccttttgttcttcttcctctgctattgaca
attttctcaaggtga

DBGET integrated database retrieval system