KEGG   Meleagris gallopavo (turkey): 100546388Help
Entry
100546388         CDS       T01523                                 

Definition
intraflagellar transport protein 27 homolog
Orthology
K07934  
intraflagellar transport protein 27 homolog
Organism
mgp  Meleagris gallopavo (turkey)
Brite
GTP-binding proteins [BR:mgp04031]
 Small (Monomeric) G-proteins
  Rho Family
   Others
    100546388
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
1
AA seq 186 aa AA seqDB search
MVKLSAKCLLAGDPAVGKSALAQMFRNDGAHFQKNYTLTTGIELLVKAISVPETSDSVEF
FIFDSAGKDLFSQTLEKLWEQPNVLCLVYDVTNEQSFNNCAKWLEKLRAQAVGMHIPGVL
VGNKTDLVGRRVVEQKQAQEWADKHGLEYCEMSVKEMKNFEAPFNILAKSFYQLYKEKVE
TFHSLA
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atggtgaagctctccgccaagtgcctgctggcaggtgatccagctgtggggaagagtgct
ttagcccagatgttccgcaatgatggggctcattttcagaagaactatacattgacaacg
ggcattgaactgttggtgaaggctatatcagttccagagacaagtgatagtgtggaattc
ttcatttttgactctgcaggcaaagatctattttctcagacgctggagaaactgtgggag
caaccaaatgtcctgtgccttgtgtatgatgtcactaatgagcaatctttcaacaactgt
gccaagtggctggaaaagctgagggcacaagcagttggaatgcacatcccaggtgtctta
gtggggaataaaacagatctggttggtcgtcgagttgtggaacagaaacaagcacaggaa
tgggctgacaaacatggcctggaatactgcgagatgtcagtaaaggagatgaaaaatttt
gaggcccctttcaacatcctggcaaagtcattctaccaactgtacaaagaaaaagtggaa
acctttcactcactagcttga

DBGET integrated database retrieval system