KEGG   Meleagris gallopavo (turkey): 100546388Help
Entry
100546388         CDS       T01523                                 

Definition
intraflagellar transport protein 27 homolog
Orthology
K07934  
intraflagellar transport protein 27 homolog
Organism
mgp  Meleagris gallopavo (turkey)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
1
AA seq 186 aa AA seqDB search
MVKLSAKCLLAGDPAVGKSALAQMFRNDGAHFQKNYTLTTGIELLVKAISVPETSDSVEF
FIFDSAGKDLFSQTLEKLWEQPNVLCLVYDVTNEQSFNNCAKWLEKLRAQAVGMHIPGVL
VGNKTDLVGRRVVEQKQAQEWADKHGLEYCEMSVKEMKNFEAPFNILAKSFYQLYKEKVE
TFHSLA
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atggtgaagctctccgccaagtgcctgctggcaggtgatccagctgtggggaagagtgct
ttagcccagatgttccgcaatgatggggctcattttcagaagaactatacattgacaacg
ggcattgaactgttggtgaaggctatatcagttccagagacaagtgatagtgtggaattc
ttcatttttgactctgcaggcaaagatctattttctcagacgctggagaaactgtgggag
caaccaaatgtcctgtgccttgtgtatgatgtcactaatgagcaatctttcaacaactgt
gccaagtggctggaaaagctgagggcacaagcagttggaatgcacatcccaggtgtctta
gtggggaataaaacagatctggttggtcgtcgagttgtggaacagaaacaagcacaggaa
tgggctgacaaacatggcctggaatactgcgagatgtcagtaaaggagatgaaaaatttt
gaggcccctttcaacatcctggcaaagtcattctaccaactgtacaaagaaaaagtggaa
acctttcactcactagcttga

DBGET integrated database retrieval system