KEGG   Meleagris gallopavo (turkey): 100546503Help
Entry
100546503         CDS       T01523                                 

Definition
integrin alpha-8-like
Orthology
K06584  
integrin alpha 8
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
Focal adhesion
ECM-receptor interaction
Cell adhesion molecules (CAMs)
Regulation of actin cytoskeleton
Class
Environmental Information Processing; Signaling molecules and interaction; ECM-receptor interaction [PATH:mgp04512]
Environmental Information Processing; Signaling molecules and interaction; Cell adhesion molecules (CAMs) [PATH:mgp04514]
Cellular Processes; Cell motility; Regulation of actin cytoskeleton [PATH:mgp04810]
Cellular Processes; Cell communication; Focal adhesion [PATH:mgp04510]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
6
AA seq 926 aa AA seqDB search
MQFDIFINDMDSGIKGTIGNFADDSTLCSAVMREERNTIQRNLNRLEXXXXXXPRANTTQ
PDIVEGGAVYHCGWPAARCRQIPFDNTNNRKIKVNGTREPIEFKTNQWFGATVKAHKEKV
VACAPLYHWRTLKDSPEKDPVGTCYVAIQNFSAYAEYSPCRNSNADPEGQGFCQAGFSLD
FYKNGDLIVGGPGSFYWQGQVITASIADIIANYSFKDILRKLAREKQTGVAPPTYDDNYM
GYSVAAGEFTGDSEEELVAGVPRGAQNFGYVSIINSSDLTLIQNFTGEQMASYFGYTVAV
SDVNNDGLDDILVGAPLFMEREFESKPKEVGQVYLYLQESAFLFRDPQILTGTEVFGRFG
SAITHLGDLNQDGYNDIAIGAPFAGEDRRGKVLIYNGYSNGLKTDPSQVLNGAWASQSMP
SGFGFTLRGDSDVDKNDYPDLIVGAFGAGKAVVYRARPVVTVNALLILNPMIVNPDNKTC
QPPGSQLLVACFTVRVCAAFEGQSISDEIVLNSELQLDSLKQKGAVKRTLFFDYHQSNHY
FFIVMEKQKKLYCQDFLVYLRSYVLHRDKDQLIIGEENCVMLIINPRNDGEGAYEAELHI
KIPPEADYTGVERNSKALRVLSCDYKMENETRMVVCDLGNPMVAGANFSTGIRFSVQHFE
NSDFSINFELQIKSSNKVNSTSNLVNLHINITAAAQVQVRGLDESHFKDSMMVKPILNYY
QRSSVTEQLHNIGPSAINNTVLHVGWPASSREEFLLYILHIQTHGPLHCQTSSPINIMQI
SFAIPQDTPELAAFLYNSTISHYIRRREVAMAEPYRRNAAKILRKNDLYTLSSNVSFKVK
NMPYKVQPAKLPEGSIAIRTSVIWSTPNVSFVIPLWVIILAIMLGLLVLAVLTLALWKCG
FFDRARPPQDDMADREQLTNNKTTDA
NT seq 2781 nt NT seq  +upstreamnt  +downstreamnt
atgcagtttgatatctttattaatgatatggacagtgggatcaagggcaccatcgggaat
tttgcggatgactccacactgtgcagtgcggtcatgagagaagaaaggaacaccatccag
aggaacctgaacaggcttgagagnnnnnnnnnnnnnnnnccccgagccaacaccacgcag
ccggacatcgtggaaggaggagcggtgtaccactgcggctggccggccgcgcgctgcagg
cagatccccttcgataacaccaacaacaggaaaattaaggtcaatggcaccagggaacca
attgagtttaagaccaatcagtggtttggggcaacagtcaaagctcataaagaaaaagtt
gtggcctgtgctcccttatatcattggaggactcttaaagacagcccagagaaggaccct
gttggcacctgctatgtagcaattcagaacttcagtgcctatgctgaatactcaccttgt
cgcaacagcaatgcagatcctgaaggacaaggcttttgtcaagcaggtttcagtttagat
ttttacaagaatggagacctcatagtaggcgggcctggtagtttttattggcaaggtcag
gtaatcactgcaagcattgcggatatcattgcaaattattccttcaaggatattctgagg
aaactggcacgagagaagcaaacaggagttgcaccacctacatatgatgacaactatatg
ggatactcagtagctgctggggaatttactggagattctgaagaagagctggttgctgga
gtcccaaggggtgcgcagaactttggctacgtctcaatcattaattcttcagatttgacc
ttaatccagaatttcaccggtgaacagatggcgtcttattttgggtacactgttgcagta
tctgatgttaacaatgatggtttagatgatatcttagttggggcccctctgtttatggaa
cgagaatttgagagcaagcctaaagaagtcgggcaagtctacctgtacctgcaggaaagt
gctttcctcttccgagatccgcaaattctgacaggcactgaagtgttcggtagatttggc
agtgcaatcactcaccttggagatctcaatcaggatggatataatgacattgccattggt
gcaccatttgcaggtgaagacagaagaggtaaagtgctcatttacaatggatacagtaat
gggttaaaaactgacccttcccaggttctcaacggagcctgggcatcacagtccatgcct
tcgggatttggcttcactctaagaggagactcagatgtagacaagaatgattacccagat
ttaattgtaggcgcgtttggagctggaaaagcagttgtttacagagccagacctgttgtg
actgtgaatgctctgctcattctgaaccccatgattgtgaatccagacaacaagacctgt
cagccccctggctctcagcttttggtagcctgttttactgtaagagtctgcgcagcattt
gaaggccaaagtatttcagatgagatagtgctgaacagcgaattgcaattagattcattg
aaacagaaaggagctgttaaaaggactctcttctttgattaccatcagtcaaatcattat
ttcttcattgtgatggaaaaacagaagaagctctattgccaggactttcttgtttatctc
agatcatatgttctgcatagagataaagatcagctaataattggagaagaaaactgtgtc
atgctcataataaatccaaggaatgatggggaaggagcctatgaagctgagctgcatata
aagattccacctgaagcagattacactggggttgaacgcaacagcaaggcactgcgtgtg
ttgagctgtgattacaagatggaaaatgaaaccagaatggtggtttgtgatcttgggaac
cccatggtggctggcgcaaatttctctacaggtatccgattttctgttcagcattttgag
aattcagatttcagcatcaattttgagctgcaaataaaaagttctaataaggttaattcc
accagcaatttagttaaccttcatatcaacatcactgctgcggctcaggtgcaggtcaga
ggcttggatgaatctcatttcaaagatagcatgatggtgaagccaatactgaattattac
cagagaagctcagtaacagaacagcttcacaatataggaccaagtgccatcaacaataca
gttctccatgttggttggcctgcatccagtcgagaagagtttcttctttacattctacat
attcagacacatggaccactgcactgtcaaacaagctctcctattaatataatgcaaatc
agctttgctattccacaggacactcctgaacttgctgcttttttatataattccacgatt
tctcattacatcaggagaagggaggtagccatggcagaaccttacaggaggaacgctgca
aaaatactgaggaaaaatgatctctatactctttcttccaatgtgtccttcaaagttaag
aacatgccctataaagtgcagccagcgaagctccctgagggaagcatagcaatcagaaca
tcagtcatttggtccactccaaatgtctcctttgttatccctttgtgggttataatacta
gcaataatgcttggtctactggtactagcggtgttgacccttgctttatggaagtgcggc
ttctttgacagagctagacccccacaagatgacatggcagacagagaacagctgacaaat
aacaagactactgatgcatag

DBGET integrated database retrieval system