KEGG   Meleagris gallopavo (turkey): 100546503Help
Entry
100546503         CDS       T01523                                 

Definition
integrin alpha-8
Orthology
K06584  
integrin alpha 8
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
Focal adhesion
ECM-receptor interaction
Cell adhesion molecules (CAMs)
Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:mgp00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    100546503
   04514 Cell adhesion molecules (CAMs)
    100546503
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    100546503
  Cellular commiunity
   04510 Focal adhesion
    100546503
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
6
AA seq 446 aa AA seqDB search
MEREFESKPKEVGQVYLYLQESAFLFRDPQILTGTEVFGRFGSAITHLGDLNQDGYNDIA
IGAPFAGEDRRGKVLIYNGYSNGLKTDPSQVLNGAWASQSMPSGFGFTLRGDSDVDKNDY
PDLIVGAFGAGKAVVYRARPVVTVNALLILNPMIVNPDNKTCQPPGSQLLVACFTVRVCA
AFEGQSISDEIVLNSELQLDSLKQKGAVKRTLFFDYHQSNHYFFIVMEKQKKLYCQDFLV
YLRDETEFRDKLSPININLNYSLDESHFKDSMMVKPILNYYQRSSVTEQAYILVDCGEDN
LCIPDLHLSAVPDKDQLIIGEENCVMLIINPRNDGEGAYEAELHIKIPPEADYTGVERNS
KALRVLSCDYKMENETRMVVCDLGNPMVAGANFSTGIRFSVQHFENSDFSINFELQIKSS
NKVNSTSNLVNLHINITAAAQVQVRG
NT seq 1341 nt NT seq  +upstreamnt  +downstreamnt
atggaacgagaatttgagagcaagcctaaagaagtcgggcaagtctacctgtacctgcag
gaaagtgctttcctcttccgagatccgcaaattctgacaggcactgaagtgttcggtaga
tttggcagtgcaatcactcaccttggagatctcaatcaggatggatataatgacattgcc
attggtgcaccatttgcaggtgaagacagaagaggtaaagtgctcatttacaatggatac
agtaatgggttaaaaactgacccttcccaggttctcaacggagcctgggcatcacagtcc
atgccttcgggatttggcttcactctaagaggagactcagatgtagacaagaatgattac
ccagatttaattgtaggcgcgtttggagctggaaaagcagttgtttacagagccagacct
gttgtgactgtgaatgctctgctcattctgaaccccatgattgtgaatccagacaacaag
acctgtcagccccctggctctcagcttttggtagcctgttttactgtaagagtctgcgca
gcatttgaaggccaaagtatttcagatgagatagtgctgaacagcgaattgcaattagat
tcattgaaacagaaaggagctgttaaaaggactctcttctttgattaccatcagtcaaat
cattatttcttcattgtgatggaaaaacagaagaagctctattgccaggactttcttgtt
tatctcagagatgaaacagaatttagagataaattatctcctatcaatataaacttgaat
tatagcttggatgaatctcatttcaaagatagcatgatggtgaagccaatactgaattat
taccagagaagctcagtaacagaacaggcttacattctggtagactgtggggaggataac
ttgtgcattcctgacttgcacctttctgctgtgccagataaagatcagctaataattgga
gaagaaaactgtgtcatgctcataataaatccaaggaatgatggggaaggagcctatgaa
gctgagctgcatataaagattccacctgaagcagattacactggggttgaacgcaacagc
aaggcactgcgtgtgttgagctgtgattacaagatggaaaatgaaaccagaatggtggtt
tgtgatcttgggaaccccatggtggctggcgcaaatttctctacaggtatccgattttct
gttcagcattttgagaattcagatttcagcatcaattttgagctgcaaataaaaagttct
aataaggttaattccaccagcaatttagttaaccttcatatcaacatcactgctgcggct
caggtgcaggtcagagggtaa

DBGET integrated database retrieval system