KEGG   Meleagris gallopavo (turkey): 100546503Help
Entry
100546503         CDS       T01523                                 

Definition
(RefSeq) integrin alpha-8
  KO
K06584  
integrin alpha 8
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
Focal adhesion
ECM-receptor interaction
Cell adhesion molecules (CAMs)
Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:mgp00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    100546503
   04514 Cell adhesion molecules (CAMs)
    100546503
 Cellular Processes
  Cellular community - eukaryotes
   04510 Focal adhesion
    100546503
  Cell motility
   04810 Regulation of actin cytoskeleton
    100546503
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
Position
6
AA seq 446 aa AA seqDB search
MEREFESKPKEVGQVYLYLQESAFLFRDPQILTGTEVFGRFGSAITHLGDLNQDGYNDIA
IGAPFAGEDRRGKVLIYNGYSNGLKTDPSQVLNGAWASQSMPSGFGFTLRGDSDVDKNDY
PDLIVGAFGAGKAVVYRARPVVTVNALLILNPMIVNPDNKTCQPPGSQLLVACFTVRVCA
AFEGQSISDEIVLNSELQLDSLKQKGAVKRTLFFDYHQSNHYFFIVMEKQKKLYCQDFLV
YLRDETEFRDKLSPININLNYSLDESHFKDSMMVKPILNYYQRSSVTEQAYILVDCGEDN
LCIPDLHLSAVPDKDQLIIGEENCVMLIINPRNDGEGAYEAELHIKIPPEADYTGVERNS
KALRVLSCDYKMENETRMVVCDLGNPMVAGANFSTGIRFSVQHFENSDFSINFELQIKSS
NKVNSTSNLVNLHINITAAAQVQVRG
NT seq 1341 nt NT seq  +upstreamnt  +downstreamnt
atggaacgagaatttgagagcaagcctaaagaagtcgggcaagtctacctgtacctgcag
gaaagtgctttcctcttccgagatccgcaaattctgacaggcactgaagtgttcggtaga
tttggcagtgcaatcactcaccttggagatctcaatcaggatggatataatgacattgcc
attggtgcaccatttgcaggtgaagacagaagaggtaaagtgctcatttacaatggatac
agtaatgggttaaaaactgacccttcccaggttctcaacggagcctgggcatcacagtcc
atgccttcgggatttggcttcactctaagaggagactcagatgtagacaagaatgattac
ccagatttaattgtaggcgcgtttggagctggaaaagcagttgtttacagagccagacct
gttgtgactgtgaatgctctgctcattctgaaccccatgattgtgaatccagacaacaag
acctgtcagccccctggctctcagcttttggtagcctgttttactgtaagagtctgcgca
gcatttgaaggccaaagtatttcagatgagatagtgctgaacagcgaattgcaattagat
tcattgaaacagaaaggagctgttaaaaggactctcttctttgattaccatcagtcaaat
cattatttcttcattgtgatggaaaaacagaagaagctctattgccaggactttcttgtt
tatctcagagatgaaacagaatttagagataaattatctcctatcaatataaacttgaat
tatagcttggatgaatctcatttcaaagatagcatgatggtgaagccaatactgaattat
taccagagaagctcagtaacagaacaggcttacattctggtagactgtggggaggataac
ttgtgcattcctgacttgcacctttctgctgtgccagataaagatcagctaataattgga
gaagaaaactgtgtcatgctcataataaatccaaggaatgatggggaaggagcctatgaa
gctgagctgcatataaagattccacctgaagcagattacactggggttgaacgcaacagc
aaggcactgcgtgtgttgagctgtgattacaagatggaaaatgaaaccagaatggtggtt
tgtgatcttgggaaccccatggtggctggcgcaaatttctctacaggtatccgattttct
gttcagcattttgagaattcagatttcagcatcaattttgagctgcaaataaaaagttct
aataaggttaattccaccagcaatttagttaaccttcatatcaacatcactgctgcggct
caggtgcaggtcagagggtaa

DBGET integrated database retrieval system