KEGG   Meleagris gallopavo (turkey): 100546504Help
Entry
100546504         CDS       T01523                                 

Definition
histone deacetylase 4-like
Orthology
K11406  
histone deacetylase 4/5 [EC:3.5.1.98]
Organism
mgp  Meleagris gallopavo (turkey)
Brite
Enzymes [BR:mgp01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     100546504
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
7
AA seq 1081 aa AA seqDB search
MSSQSHPDGLSGREQPVELLNPPRVNHMPSSVDVSTALPLQVAPTSVPMDLRLDHQFPMP
VTEPTLREQQLQQELLALKQKQQIQRQILIAEFQRQHEQLSRQHEAQLHEHIKQQQEMLA
MKHQQELLEHQRKLEQHRQEQELEKQHREQKLQQLKNKEKGKESAVASTEVKMKLQEFVL
NKKKALAHRNLNHCISSDPRFWYGKTQHSSLDQSSPPQSGVSGTYNHPVLGMYDSKDDFP
LRKTASEPNLKLRSRLKQKVAERRSSPLLRRKDGPVVTALKKRPLDVTDSACNSAPGSGP
SSPNNSSNNISAENGITGSVTSIQAETSLAHRLVNREGSVTQLPLYTSPSLPNITLGLPA
TGPSSGGSAQQDAERLAIPALQQRISLFPGTHLTPYLSTTTLERDGGTAHNPLLQHMVLL
EQPTAQTPLVTGLPLHAQSLVGGERISPSIHKLRQHRPLGRTQSAPLPQNAQALQQLVIQ
QQHQQFLEKHKQQFQQQQLHINKIISKPNEPARQHESHPEETEEELREHQALLEEPYSDR
VSSQKEVPGLASMVQVKQEPIESDEEEAEPQQELESGQRQAEQELLFRQQALLLEQQRIH
QLRNYQASLEAAGMPVSFGGHRPLSRAQSSPASATFPMSVQEPPTKPRFTTGLVYDTLML
KHQCTCGNTNSHPEHAGRIQSIWSRLQETGLRGKCECIRGRKATLEELQTVHSEAHTLLY
GTNPLNRQKLDSKKLLGSLTSMFVRLPCGGVGVDSDTIWNEVHSSGAARLAVGCVIELVF
KVATGELKNGFAVVRPPGHHAEESTPMGFCYFNSVAIAAKLLQQRLNVSKILIVDWDVHH
GNGTQQAFYNDPNVLYISLHRYDDGNFFPGSGAPDEVGTGAGVGFNVNMAFTGGLDPPMG
DTEYLTAFRTVVMPIANEFAPDVVLVSSGFDAVEGHPTPLGGYNLSAKCFGYLTKQLMGL
AGGRVVLALEGGHDLTAICDASEACVSALLGNELDPLPEKVLQQRANANAVHSMEKVIEI
HSKYWHSLQRYASTVGYSLVEAQKCENEEAETVTAMASLSVGVKPAEKRPDDEPMEEEPP
L
NT seq 3246 nt NT seq  +upstreamnt  +downstreamnt
atgagctcccaaagccatccagatgggctttctggcagagaacagccagtagagctgttg
aatccacctagagtgaaccacatgcccagctctgttgatgtgagcacagcactgcccttg
caagttgccccaacctcagtcccgatggatctgcgcctggaccaccagttccccatgcct
gtgacagagccaacgctccgtgagcagcagctgcagcaggagctcctggcgctgaagcag
aagcagcagatccagaggcagatcctcattgctgagttccagcggcagcatgagcagctc
tccaggcagcacgaggcccagctgcatgagcacatcaagcagcagcaggagatgctggca
atgaagcatcagcaggagcttctggagcaccagaggaagctggagcagcaccggcaggag
caggagctggagaagcagcaccgggagcagaaacttcaacagctgaaaaacaaagagaaa
ggaaaggagagcgcagtggcaagcacagaagtaaagatgaaattacaagaatttgtttta
aataagaagaaggctttggcacaccggaatctcaaccactgcatttccagtgaccctcgc
ttctggtatgggaagacacagcacagctccttggaccagagctccccacctcaaagtggc
gtatctggcacctacaatcaccctgtcctggggatgtacgattccaaagatgacttccca
ctcagaaaaacagcatctgaacccaacctgaaattacgatccagactaaagcaaaaagtt
gctgaacgacggagcagccccctgttgcgcaggaaggatggcccagtggtcactgctctg
aagaagcgcccgctggatgtcacagactctgcatgcaacagtgctcctggatctggtccc
agctctccaaacaacagttccaataacatcagcgctgagaatggaattacaggatcggtc
acgagtattcaggcggagaccagcctggctcaccgactggtgaatcgtgaaggctctgta
acacagcttccactctacacttctccttctttgcccaacatcacactaggactgcctgca
actggcccttccagcggaggatcagcacagcaggatgctgagagacttgctatcccagcc
ttgcagcagcggatctctttatttcctggcacccacctcactccctacttgagcactaca
acgttggaaagagatgggggaaccgcacacaaccctcttctgcagcacatggtcttactg
gaacagccaactgcacaaactcccttagtcacaggactgcccctccacgcacagtctctg
gttggtggagaacggatctccccttcaatacacaaactccggcagcatcgcccactgggg
cgcacgcagtctgctccccttccacagaacgcccaagccctccagcagttagtgatccag
cagcagcaccagcagttcttggagaaacacaaacagcaattccaacaacaacaactgcat
atcaacaagataatatcaaaacccaacgagccagctcgccagcatgaaagccacccagag
gagacagaagaagagcttcgagaacaccaagcccttttggaggagccatacagtgacaga
gtgtcaagccaaaaggaggtcccagggctggccagtatggtgcaggtgaagcaagaaccc
atcgagagtgatgaggaggaagctgagccgcagcaggagctggagtctgggcagaggcag
gctgagcaggagctcctcttccgccagcaagccctcctgttggagcagcagcgcattcac
cagctgagaaactaccaggcatcgctggaggcagctggcatgccagtctcctttgggggc
catcggcctctgtcccgtgcacagtcctcacctgcctcggccaccttccctatgtctgta
caggaaccacccactaagccaaggttcactacaggccttgtctatgacaccttgatgctg
aaacatcagtgtacctgtggaaacacaaacagccacccggagcatgcagggaggatccag
agcatctggtccaggctgcaggagacaggtctccgtggcaagtgcgagtgcattcgtgga
agaaaagcaactctagaagagctgcagacagttcactcagaagctcatacactgctgtac
ggcacaaaccctctgaacagacagaaactggacagcaagaaacttctaggttctctaacg
tcgatgtttgtcaggcttccttgcggtggtgtcggggtcgacagtgacacgatctggaat
gaagttcactcatctggtgctgctcgcctggctgtgggctgcgtcattgagcttgttttc
aaagtggccacaggagaactgaagaatggatttgctgttgttcgacctccaggtcaccat
gcagaagaaagcacacccatgggcttctgctatttcaactccgtggcaattgcagccaag
ctgctccagcagaggctgaatgttagcaaaatcctcatagtggactgggatgtgcaccat
gggaacggtactcagcaagctttctacaatgatcctaatgttctttatatttcactacat
cgctatgatgatgggaacttctttccaggcagtggtgctcctgatgaggttggcacagga
gcaggagttgggttcaatgttaacatggccttcactggaggccttgatccaccgatggga
gacacagaatacttaactgctttcaggacggtcgtaatgcccattgccaatgaatttgcc
ccagatgttgtgctggtgtcatctggttttgatgcggtagaaggccatcctacgcctctg
ggaggatataatctctctgcaaaatgctttgggtacctgacgaagcagctgatgggcctg
gccggaggccgcgtcgtcctggccctcgaaggaggccacgacctgactgccatttgcgat
gcctcagaagcatgtgtttctgctttgctgggaaacgagctcgaccctcttccagaaaaa
gttctccagcagagagcaaatgctaatgcggtgcattcaatggagaaagtgattgagata
cacagcaagtattggcattcactccagcgctatgcctccacagtgggctattccctggtt
gaggcacagaagtgtgagaacgaagaggctgagacagtgacagccatggcatctctgtca
gtaggcgtgaagccagctgagaagcgacccgatgatgaacctatggaagaggaacctccc
ctgtag

DBGET integrated database retrieval system