KEGG   Meleagris gallopavo (turkey): 100546541Help
Entry
100546541         CDS       T01523                                 

Definition
glycerol kinase-like
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
Glycerolipid metabolism
Metabolic pathways
PPAR signaling pathway
Brite
KEGG Orthology (KO) [BR:mgp00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    100546541
 Organismal Systems
  Endocrine system
   03320 PPAR signaling pathway
    100546541
Enzymes [BR:mgp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     100546541
Exosome [BR:mgp04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100546541
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1
AA seq 783 aa AA seqDB search
MELNSTRAHATRSALILAHGSLALQASKEQLLARLEGDIVGNILLLYSCSCRDLQNKLAL
VQSITDFSSAFHAVGGSAFFNPFLKSKLLEILMGGDACKHFGSLVGFLAPLTCDPMPTSR
QLAATCLSSLLRIQAKAANRVIKLGDIGSLCEGLNDSSTIAQLRTLSKIARMVCRNFPLE
QTVDFMMAIEDTFRKGRGMRVRAAGKWMITLLLMYGKDIHWDAALIVYILRSCMSSMKQS
TFMPFLCQAMVILTRCHAEVTIDNFFQLLEPTDRKSNCVIYLQVFNAKTAELLSHHQVEI
QQKFPKEGWVEQDPKEILKSVLECVERTCEKLQQLNIDITNIKAIGVSNQRETTVVWDKT
TGEPLYNAIVWLDLRTQSTVERLLKRIPGNNKSFFKFRTGLPLSTYFSAVKLRWLLDNVE
EIRQAVDDGRAMFGTIDSWLIWCLTGGKNGGVHCTDVTNASRTMLFNIHSLDWDPELCQF
FDIPMEILPKVRSSSEIYGLMKSGALTGVPISGCLGDQSAALVGQMCFQDGQAKNTYGTG
CFLLCNTGQKSVFSDHGLLTTIAYKLGRDKPVCYALEGSVAIAGAVVRWLRDNLGIVKTS
QEVEKLAAEAGTSYGCYFVPAFSGLYAPYWEPSARGIICGLTQFTNKNHIAFAALEAVCF
QTREILDAMNKDCGIPLSQLQVDGGMTNNKVLMQLQSDILCIPVVKPSMPETTALGAAMA
AGAAEGVGIWSLNPGDLTAVTCERFEPQINPEESEYRYARWKKAVMKSMDWETSEAPSNG
TDK
NT seq 2352 nt NT seq  +upstreamnt  +downstreamnt
atggagctgaacagcacgagagctcacgccacacgcagcgctctcatccttgcccatggc
agcttggcactgcaagcctccaaggaacagctgcttgcccgcctggagggagacattgtg
ggcaacatcctgctgctgtacagctgcagctgtcgggacttgcagaacaagctcgcgctg
gtgcagagcatcactgacttcagctctgccttccatgctgtgggtggctccgccttcttt
aacccctttttgaagagcaagctgctggagatcctgatggggggagatgcctgcaagcac
tttggctccttggtgggatttctggcacctctgacatgtgatcctatgcccacatcccgc
cagttggctgccacctgcctgagctcccttctccgaatccaagccaaggcagccaacaga
gtcatcaaactgggagacatcgggagcctgtgtgaggggctgaatgacagcagcaccatt
gctcagctccggaccttgtccaaaattgcaaggatggtgtgcagaaacttccccctggaa
caaactgtcgacttcatgatggccatcgaggataccttccggaaaggcagaggaatgcgc
gtgcgtgcagctgggaagtggatgatcacccttctgctgatgtacgggaaggacatccat
tgggacgcggcactgattgtctacatcctgcgcagctgcatgtcatccatgaagcagagc
acgttcatgcccttcctttgccaggcaatggtcatcctcacccgctgccatgcagaggtc
acaattgacaacttcttccagctgcttgagccaacagacagaaaatccaactgtgtaatt
tatttgcaggtatttaatgcaaaaacagcagagctcctgagtcaccatcaagtagagata
cagcagaaattccctaaggaaggatgggtggaacaagatccaaaggaaatcttaaagtca
gtccttgaatgtgtggaaagaacctgtgagaaactgcagcaactgaacatagacatcact
aacataaaagccattggagttagcaaccagagggaaacaacagtggtttgggacaagacg
actggagaacctctttataatgccattgtgtggcttgacctaagaactcagtcaacagtt
gaaagacttctaaagagaattcctggaaataacaaatccttttttaagtttaggactggt
cttccacttagcacctacttcagtgcagtgaaacttcggtggcttttggataatgtggaa
gagattaggcaagcagttgatgatggaagagcaatgtttggaactattgattcgtggctt
atatggtgtttgacaggtgggaagaatggaggtgttcactgtacagatgtaactaatgcc
agtagaacgatgttgttcaacattcattccttggactgggatcccgagctctgccaattc
tttgatattcctatggaaatacttccaaaagtacgaagctcatctgagatttatggcctg
atgaaatctggagctttgacaggtgtaccaatttctgggtgcttgggtgaccagtctgct
gctcttgttgggcaaatgtgcttccaagatgggcaggcaaaaaacacatatggaacagga
tgtttcttgctgtgcaatacaggtcagaagtccgtgttttctgaccatggtcttctaacc
acgatagcgtacaaactgggcagagacaaacctgtttgttatgcgttagaaggatctgtt
gcaatagctggtgccgttgttcgttggctgagggacaatctaggtattgttaaaacttca
caggaagttgaaaaactggctgcagaagcgggaacttcttatggctgctactttgtgcca
gcattttcaggactgtacgcaccttactgggaacccagtgcaaggggcattatctgtggc
cttacccagtttacaaacaaaaaccacattgcctttgctgcactagaagcagtctgcttc
caaacacgagagattttagatgcaatgaacaaagactgtgggataccattaagtcagtta
caagtagatggaggaatgaccaataacaaagttctcatgcaactccagtcagacatcctg
tgtattccagtagtgaagccatcaatgcctgaaacaacagctctaggagctgctatggca
gcaggagctgcagaaggagttggaatttggagtctgaatcctggagatttgacagcagtg
acatgtgaacgatttgaaccacagatcaacccagaggaaagtgaatatcgctatgccaga
tggaagaaagctgtgatgaaatctatggactgggaaacatctgaagctccttcaaatggt
acagataaatga

DBGET integrated database retrieval system