KEGG   Meleagris gallopavo (turkey): 100546553Help
Entry
100546553         CDS       T01523                                 

Definition
transforming acidic coiled-coil-containing protein 3-like
Orthology
K14283  
transforming acidic coiled-coil-containing protein 3
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:mgp00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    100546553
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
4
AA seq 891 aa AA seqDB search
MSLQILNAENGENVSDDLTAEDCGFYFAQSEATGRPSILRLSQKENLPPKSVARAMKVTF
QTPLRDPQSRKILSPTMTDKLESTFTLDDCSEALQDDLSVPISTVISQQKTEAEASDTEI
NKQMPEKVSAAPYPDDEMPVKSRGSYSLDFDNLNDINPFQSSMQLQNSPANLQKSPVRVS
SSPEKTNEKSSNSLPLDNTASPSTTTSTQYPSKQDNTSSSGKKSVLLESNKPDLFPKHTI
GDSLQESPSTEVSQINKSGNLDLISSDVTCSSKTGESKLQTVPVPEKASTEELKPLEEPA
ISKGEPAEKPGVTKAGPVKLEFDFDNTSVRKPPPKKLGKRLGIKPPSKKTFNTKLKTENS
EVENKSNVEDEAPVPRASYKFDWDKLDDPNFNPFGGGSKVSTSPKCSEPSSQKVPQQEEQ
DSASPRREHLPVERDNRPNSCEILERKEPRSPEIHKQNVVEDEPQKQEDKPEVQGQADLL
VELSMGKQISPSKMSPANVPSQDNLVSADSGKRSMCADEIKPTSHRNEITADQQTASAEP
EELFRPSSEVLGMGIDYLEQFGTSSFKESALRKQSLYLKFDPLLRDSPRKQPIFGTTEAN
TNIMTAPLQCGPTSDLNKLLEENENPASSLQNEEKPKGLDLLGTFTTSDPGLIIPDSLAH
DVSPLAFTASTNTAVDAIIDVLKYSQKDMDAVVELVKREVQEKELETLEWKQKYNKLHVE
YKEMGKVVAEFEGTITQMMEDSQKQKELSKKEIQRMVEEKQQVISDLNSMETSFSELFKR
FEKQKEVLEGYRKNEEALKKCAEEYLARIKKEEQRYQALKAHAEEKLHQANEEIAQVRNK
AKSEIAALQASLRKEQMRIQSLERSLEQKTKENDELTKICDDLILKMGKNG
NT seq 2676 nt NT seq  +upstreamnt  +downstreamnt
atgagtctgcagatcttaaatgcagaaaatggagaaaacgtcagtgatgatctaacagcg
gaagactgtggcttttactttgcacaatcggaagctacagggagaccttctattctgcgc
ctgtcccagaaagaaaatttgccaccaaaaagtgtggcgagagctatgaaggtaaccttt
caaactcctctaagagatcctcagtctcgaaaaatattaagtcccaccatgacagacaaa
cttgagtctactttcacacttgatgattgcagtgaagccttgcaggatgatctctctgtg
cccatcagcactgtcataagtcaacagaagactgaagctgaagcaagtgatacggagata
aataaacaaatgccagagaaagtcagcgctgctccttacccagatgatgagatgccagtg
aagagccgaggttcctacagtcttgattttgataacttaaatgacatcaatccctttcag
agttcaatgcagctgcagaattctcctgcaaacctgcaaaagtctcctgtaagggtatct
agcagccctgaaaaaactaatgagaaaagtagcaattctcttccgctggataatacagct
tctccttcaacaactacaagtacgcagtatcccagtaaacaggataatacttcttcctct
ggaaaaaaatctgttctgctagagtccaataaacctgatctgttcccaaagcacactatt
ggtgactctctgcaggagtctccttccacagaagtaagccaaatcaataagtctggcaat
ttggatcttattagttctgatgtgacttgttcctctaaaactggggaatcgaaacttcaa
actgttccagtaccagaaaaagcttcaacggaagagttgaagcctttagaagagcctgcc
atctccaaaggggaacctgcagaaaagcctggtgtcaccaaggctggaccagtaaaactg
gaatttgactttgataacaccagtgttagaaaaccacctcctaagaaactaggtaaaaga
cttggaattaaaccaccttccaaaaaaacttttaataccaaactgaaaacagagaatagt
gaagtggaaaataaaagtaatgtggaagacgaagctcctgttcctagggcatcctataag
tttgactgggacaaacttgatgatccaaactttaatccttttggaggaggttctaaagtt
tccacctcacccaagtgttctgagcccagctctcagaaagttccccagcaggaagagcag
gatagtgcctcaccaagaagagagcatcttccagtggaacgggataacagaccaaatagc
tgtgaaattcttgagagaaaagaaccaagaagtccggaaatccacaaacaaaatgtggtg
gaagatgagccacaaaagcaagaagacaagccagaagttcaaggacaagctgatcttctg
gtagagctatccatggggaaacaaataagcccatctaaaatgtctccagcaaatgtcccc
tctcaagataatttagtttctgctgacagtggaaaaaggtcaatgtgtgcagacgaaatt
aaacctacttctcacagaaatgaaataacagcagatcagcagacagctagtgctgaaccc
gaagagctcttcagaccatcatcagaagttctcggaatgggcatagactatctggagcaa
tttggaacttcatctttcaaagagtctgctttgaggaagcagtcattgtatttgaagttt
gatcctctgttgagagacagtcccagaaagcaaccaatttttggtactactgaagcaaat
acgaatatcatgactgctccacttcagtgtggccctacttctgatttaaacaaactgctt
gaagaaaatgagaatcctgcatcaagtcttcagaatgaggaaaaaccaaaagggctagat
cttctaggaacttttacaacttctgatcctggtctcataattccagactccctggcacat
gatgtttctccactcgcttttactgcttccacaaacactgcagtggatgctattatagat
gtgctgaaatacagccaaaaagatatggatgcagttgttgaactagttaaaagagaggtt
caagagaaagagttggagactctggaatggaaacagaagtacaacaagcttcacgtggaa
tacaaggaaatggggaaagtagttgcagagtttgaaggtacaataacccaaatgatggag
gattctcagaaacagaaggagctttcaaagaaagaaatacagaggatggtagaagaaaag
cagcaagttatttcagatctgaactctatggagacatctttctcagaactcttcaagcgt
tttgaaaaacagaaagaagtgctggagggttatcgcaaaaatgaagaagctttgaaaaaa
tgtgctgaagaatatctggctagaattaagaaagaggaacagagatatcaggcactaaag
gcacatgctgaagaaaagctgcatcaagcaaatgaggaaattgcccaggtacgaaacaaa
gctaaatcagaaattgcagccctacaagccagtctccgcaaagaacaaatgagaatccag
tctttagagaggagccttgaacaaaagacaaaagaaaatgatgaactaacgaagatctgt
gatgacttgattttgaagatgggaaaaaatggatag

DBGET integrated database retrieval system