KEGG   Meleagris gallopavo (turkey): 100546641Help
Entry
100546641         CDS       T01523                                 

Gene name
TTK
Definition
(RefSeq) TTK protein kinase
  KO
K08866  
serine/threonine-protein kinase TTK/MPS1 [EC:2.7.12.1]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
Cell cycle
Brite
KEGG Orthology (KO) [BR:mgp00001]
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    100546641 (TTK)
Enzymes [BR:mgp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     100546641 (TTK)
Protein kinases [BR:mgp01001]
 Serine/threonine protein kinases: Other group
  TTK family
   100546641 (TTK)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Position
2
AA seq 879 aa AA seqDB search
MEEEEDLSERGLPRIASIMSRVRDLKNKYKNEDNITDELNCTKISADTTDNSGTVNRIMM
TNNPEDWLCFLLRLEKKGSPQMDLSVLNRLIGRYSQAVTALPAEKHSEDENYARILVRFA
ELKALQDPEEARDQFHLARLNCKKFAFVHVAFAQFELSQGNVKKCKQLLQKAVECSAVPL
EMLETALQNFNSQKKQLLSDEEKENFAVSSIQESGLQSIVGNQRNIKRNDSTENSSAVAK
LLLGEEKSQELDPMVNFHNPLRPLNKSSQACPFGRIPVKLVNDFDDVVQKMDVPLTAGVM
KRQTSSSKCTALIPPFPLSEPKPSENDSCDLANSKLLQEKNSVQLQMLDENSLDMATNST
VTLKNKIDTSLVMKREENKLQYQELKIPEPRSMESQQQQSSSAESYRKQFDQIKLNCVNS
RKKWPSQEAMQQNCYREGKRSSLEQSGHPISRRLSPPDVSKKNELLYVCGTPSSTCADYM
ECFRTPIVRNNFSPGYQISTPYNQLPYFLPHTPATTFQNQMGLQVSASIPSNECIAIKGR
VYTILKQIGSGGSSKVFQVLNEKKQLYAVKYVNLEEADQQTVESYKNEIAHLSKLQEHSD
KIIRLYSYEITDQHIYMVMECGNIDLNSWLKKKKNIDPLERKSYWKNMLEAVHTIHEHGI
VHSDLKPANFLIVDGMLKLIDFGIANQMQPDVTSIVKDSQVGTMNYMPPEAIQDMSSSYG
ENGKSQSKISPKSDVWSLGCILYCMTYGRTPFQHITNTRKKLYAIVDPHYEIEFPDIAEK
DLQDVLKRCLVRNPKQRISVSELLIHPYVQIQTQCQTGVANAKGATEEVKRILGQLVGLN
SPNSISRAARTLYEQCNSGKSLDVSAFAKSGSQKSWTAK
NT seq 2640 nt NT seq  +upstreamnt  +downstreamnt
atggaggaggaggaggatctaagcgaaagaggattgccacgaattgcttccatcatgagt
agagttagagacttgaaaaacaaatacaaaaatgaagacaatatcacagatgaactgaac
tgtactaaaatatcagctgatacaacagataactctggaactgtgaatcgaataatgatg
acaaataatccagaagattggctgtgttttttgcttcggctggagaaaaagggtagtcct
cagatggaccttagtgtactgaacagactcattgggcgctacagtcaagcagtaactgca
ttacctgcagaaaagcatagcgaggatgagaactatgcccgcatccttgtgagatttgca
gagctgaaagctcttcaagatccggaggaggcacgagaccaatttcatctggccagactg
aactgcaagaaatttgcttttgtgcatgtggcttttgcacagtttgaactatcacaagga
aatgtgaagaagtgtaaacagctccttcagaaagctgtggagtgctctgctgttccactg
gaaatgttagaaactgctctacaaaactttaattcacaaaaaaagcagttgctttcagat
gaggaaaaggagaactttgcagtatcaagtatacaagagtctggacttcagagcatagtt
ggaaatcagagaaatataaaaaggaatgattctactgaaaattcttctgctgttgctaaa
cttcttcttggggaagagaaatcgcaagaacttgatcctatggtgaacttccacaatcca
ttaagaccactaaacaaatctagccaggcctgcccttttgggaggattcctgttaaacta
gtaaatgattttgatgatgtggtgcagaagatggatgtccctcttacagctggtgttatg
aaaaggcaaacatctagctccaaatgtacagccttgattccaccttttccgctctctgaa
ccaaaacctagtgagaatgattcatgtgacctggcaaactcaaagttattacaagaaaaa
aattctgtgcagctacagatgttggatgagaacagcttagacatggctaccaattcaact
gtcactctgaaaaacaaaatagatacaagtcttgtgatgaaaagagaagaaaataaactc
cagtatcaagagctgaagataccagagccaaggagcatggaaagtcagcagcagcaatcc
agttctgctgaaagctatagaaagcaatttgatcagataaaactgaactgtgttaactcc
agaaaaaaatggccaagtcaagaagcgatgcagcaaaactgctatagagagggaaagcgg
tcaagtcttgagcaatctggtcatcccatttcaagaaggctatcaccaccagatgtctca
aagaaaaatgagctattgtatgtttgtggaacaccaagctctacatgtgctgattatatg
gagtgtttcagaacaccaattgtaaggaacaacttttcaccaggatatcaaatttctact
ccttacaatcagctcccatattttctaccacatactccagcaactacgtttcaaaatcaa
atgggcttgcaggtttcagcttctataccttcaaatgaatgcattgctattaaaggaaga
gtttatacaatattaaagcaaataggtagtggaggctcaagcaaggtgtttcaagtactg
aatgaaaagaagcagctgtatgcagtcaagtatgtgaatctagaagaagctgatcagcag
actgttgaaagctataagaatgaaattgctcatttgagtaaactgcaagagcatagtgat
aagataatccgtctctatagctatgaaattactgatcagcatatctacatggtaatggag
tgtggaaacattgatctcaatagctggctgaaaaagaaaaagaatattgatccattggaa
cggaagagctattggaaaaatatgttggaagctgttcacacgatccacgaacacggcatt
gttcacagtgatcttaaaccagcaaactttctgatagttgacggaatgttaaaactgatt
gactttggcattgcaaaccaaatgcagccagatgtgacaagcatcgttaaagattcacag
gttggcacaatgaattatatgccacctgaagcaatacaagatatgtcttcttcctatgga
gaaaacgggaaatcgcaatctaagataagtccaaaaagtgatgtgtggtcattgggatgc
attttatattgtatgacatatggaaggactccatttcaacatataacaaatacacgtaaa
aaactgtatgctattgttgatcctcattatgaaatagaattcccagatattgctgagaaa
gatcttcaagatgtgctaaagcgctgtttagtaagaaatcctaaacaaagaatatccgtt
tcagagttgttgatacatccctatgttcaaattcaaacccaatgtcaaacaggtgttgca
aatgcaaaaggagcaacagaggaagtaaagcgtatccttggccaacttgttggcttaaat
tctcccaactctatttccagagctgctaggactttatatgaacaatgcaacagtggtaaa
agtctcgacgtatcggcatttgccaaatctgggagtcaaaaatcatggacagcaaagtga

DBGET integrated database retrieval system