KEGG   Meleagris gallopavo (turkey): 100546641Help
Entry
100546641         CDS       T01523                                 

Definition
dual specificity protein kinase TTK-like
Orthology
K08866  
serine/threonine-protein kinase TTK/MPS1 [EC:2.7.12.1]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
Cell cycle
Class
Cellular Processes; Cell growth and death; Cell cycle [PATH:mgp04110]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
2
AA seq 700 aa AA seqDB search
MEEEEDLSERGLPRIASIMSRVRDLKNKYKNEDNITDELNCTKISADTTDNSGTVNRIMM
TNNPEDWLCFLLRLEKKGSPQMDLSVLNRLIGRYSQAVTALPAEKHSEDENYARILVRFA
ELKALQDPEEARDQFHLARLNCKKFAFVHVAFAQFELSQGNVKKCKQLLQKAVECSAVPL
EMLETALQNFNSQKKQLLSDEEKENFAEKNSVQLQMLDENSLDMATNSTVTLKNKIDTSL
VMKREENKLQYQELKIPEPRSMESQQQQSSSAESYRKQFDQIKLNCVNSRKKWPSQEAMQ
QNCYREVKTPIVRNNFSPGYQISTPYNQLPYFLPHTPATTFQNQMGLQVSASIPSNECIA
IKGRVYTILKQIGSGGSSKVFQVLNEKKQLYAVKYVNLEEADQQTVESYKNEIAHLSKLQ
EHSDKIIRLYSYEITDQHIYMVMECGNIDLNSWLKKKKNIDPLERKSYWKNMLEAVHTIH
EHGIVHSDLKPANFLIVDGMLKLIDFGIANQMQPDVTSIVKDSQVGTMNYMPPEAIQDMS
SSYGENGKSQSKISPKSDVWSLGCILYCMTYGRTPFQHITNTRKKLYAIVDPHYEIEFPD
IAEKDLQDVLKRCLVRNPKQRISVSELLIHPYVQIQTQCVANAKGATEEVKRILGQLVGL
NSPNSISRAARTLYEQCNSGKSLDVSAFAKSGSQKSWTAK
NT seq 2103 nt NT seq  +upstreamnt  +downstreamnt
atggaggaggaggaggatctaagcgaaagaggattgccacgaattgcttccatcatgagt
agagttagagacttgaaaaacaaatacaaaaatgaagacaatatcacagatgaactgaac
tgtactaaaatatcagctgatacaacagataactctggaactgtgaatcgaataatgatg
acaaataatccagaagattggctgtgttttttgcttcggctggagaaaaagggtagtcct
cagatggaccttagtgtactgaacagactcattgggcgctacagtcaagcagtaactgca
ttacctgcagaaaagcatagcgaggatgagaactatgcccgcatccttgtgagatttgca
gagctgaaagctcttcaagatccggaggaggcacgagaccaatttcatctggccagactg
aactgcaagaaatttgcttttgtgcatgtggcttttgcacagtttgaactatcacaagga
aatgtgaagaagtgtaaacagctccttcagaaagctgtggagtgctctgctgttccactg
gaaatgttagaaactgctctacaaaactttaattcacaaaaaaagcagttgctttcagat
gaggaaaaggagaactttgcagaaaaaaattctgtgcagctacagatgttggatgagaac
agcttagacatggctaccaattcaactgtcactctgaaaaacaaaatagatacaagtctt
gtgatgaaaagagaagaaaataaactccagtatcaagagctgaagataccagagccaagg
agcatggaaagtcagcagcagcaatccagttctgctgaaagctatagaaagcaatttgat
cagataaaactgaactgtgttaactccagaaaaaaatggccaagtcaagaagcgatgcag
caaaactgctatagagaggtgaaaacaccaattgtaaggaacaacttttcaccaggatat
caaatttctactccttacaatcagctcccatattttctaccacatactccagcaactacg
tttcaaaatcaaatgggcttgcaggtttcagcttctataccttcaaatgaatgcattgct
attaaaggaagagtttatacaatattaaagcaaataggtagtggaggctcaagcaaggtg
tttcaagtactgaatgaaaagaagcagctgtatgcagtcaagtatgtgaatctagaagaa
gctgatcagcagactgttgaaagctataagaatgaaattgctcatttgagtaaactgcaa
gagcatagtgataagataatccgtctctatagctatgaaattactgatcagcatatctac
atggtaatggagtgtggaaacattgatctcaatagctggctgaaaaagaaaaagaatatt
gatccattggaacggaagagctattggaaaaatatgttggaagctgttcacacgatccac
gaacacggcattgttcacagtgatcttaaaccagcaaactttctgatagttgacggaatg
ttaaaactgattgactttggcattgcaaaccaaatgcagccagatgtgacaagcatcgtt
aaagattcacaggttggcacaatgaattatatgccacctgaagcaatacaagatatgtct
tcttcctatggagaaaacgggaaatcgcaatctaagataagtccaaaaagtgatgtgtgg
tcattgggatgcattttatattgtatgacatatggaaggactccatttcaacatataaca
aatacacgtaaaaaactgtatgctattgttgatcctcattatgaaatagaattcccagat
attgctgagaaagatcttcaagatgtgctaaagcgctgtttagtaagaaatcctaaacaa
agaatatccgtttcagagttgttgatacatccctatgttcaaattcaaacccaatgtgtt
gcaaatgcaaaaggagcaacagaggaagtaaagcgtatccttggccaacttgttggctta
aattctcccaactctatttccagagctgctaggactttatatgaacaatgcaacagtggt
aaaagtctcgacgtatcggcatttgccaaatctgggagtcaaaaatcatggacagcaaag
tga

DBGET integrated database retrieval system