KEGG   Meleagris gallopavo (turkey): 100546721Help
Entry
100546721         CDS       T01523                                 

Gene name
USP4
Definition
(RefSeq) ubiquitin specific peptidase 4
  KO
K11835  
ubiquitin carboxyl-terminal hydrolase 4/11 [EC:3.4.19.12]
Organism
mgp  Meleagris gallopavo (turkey)
Brite
Enzymes [BR:mgp01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100546721 (USP4)
Peptidases [BR:mgp01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100546721 (USP4)
Ubiquitin system [BR:mgp04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    100546721 (USP4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Ensembl: 
Position
14
AA seq 930 aa AA seqDB search
MLLLDENQQKNKPSQWPRRAVCCRYLLSSRWFGLWKRYVGYDRWDVSGVGDPNLFPGPID
NACLLNDGESQSLKEHLIAQLDYVLVPSSAWQKLVSWYGCIEGQQPIVRKVMEFGLYAKH
CEVEVYPLELKLCESSSPSNVISCCFSRRDSVATLVKEIRKLFKIPAEKDVRLWSSHFDG
SYEQLSELGVTLEDANIYHGELVLIEVKNEDGMWPQHPFLAKSSTASSRNFTTSSKPSAS
SYSPASATSVITNGDSSNSYGLSSSSLGRGGSGFACNSYSSGDSASLSQPGLCGLSNLGN
TCFMNSALQCLSNTPPLTDYFLEDKYEAEINHSNPLGMRGEIAEAYAELIKQIWSGRQSH
VAPRMFKTQVGRFAPQFSGYQQQDSQELLAFLLDGLHEDLNRVKKKPYLELKDANGRPDS
VVAKEAWENHRLRNDSIIVDIFHGLFKSTLVCPKCSKVSVTFDPFCYLTLPLPLKRDRLL
EVTLVPADPQRRPVQYRVVVPMMGAISDLCESLSKLSGVPAENMVVTDVYNHRFHKIFQA
DEGLNHIMPKDDIFVYEVCKPSEDGSEYITFSVYFREKAARQSSSTSGTILFGQPLLISV
PKHKLTVDHLYGVVLERISRYVKLPVAEEYSTPCPGRGACNGSSSVAEGDIEEMEHQDDG
QECREKLAEVDPCHSEGCMQIEPTRDVQPCKKQHFTFSLVNLYGTSEINSIVEGKLLKLN
AFSTLAIDWDSDTRRLLFDEQEAQAFEKHASVLQPQKMKAVVALKDCIELFTTMETLGEH
DPWYCPNCKKHQQATKKFDLWSLPKILVVHLKRFSYSRYWRDKLDTVVEFPIRGLNMSEF
VCDPRGSSYVYDLIAVSNHYGAMGVGHYTAYAKNKVNGKWYYFDDSSVSLASEDQIVTKA
AYVLFYQRRNSEEHVAPSPPQEECDGMDTN
NT seq 2793 nt NT seq  +upstreamnt  +downstreamnt
atgctactcttggatgaaaatcagcagaaaaacaaaccatcccaatggccgcgccgggcc
gtgtgttgcaggtacctgctgtccagccgctggttcggcctctggaagcgctacgtgggt
tacgacaggtgggacgtgtccggcgtgggcgaccccaacctctttcctgggcccatcgac
aacgcgtgtctgctgaacgatggggaaagtcagagcttaaaggagcacctcatcgcccag
ctggactacgtgctagtgcccagcagcgcctggcagaagctggtttcgtggtatggctgc
atcgagggacagcagcccatcgtgaggaaagtgatggaatttggtctgtatgcaaagcac
tgtgaagttgaagtttatcctcttgagctgaagctgtgtgagagcagcagtccttccaac
gtgatcagctgctgcttcagcagaagagatagtgttgccactcttgtgaaagagattcgg
aaactatttaagatcccagctgagaaggatgtgaggttatggagcagccattttgatggc
tcctacgagcagctcagcgagctgggtgtcactctagaagatgcaaacatctatcatggg
gagcttgtcctaatagaagtgaaaaatgaagatggcatgtggcctcaacatcctttcctt
gcaaagtcaagcactgcaagtagcagaaactttactacctcttcaaaaccttcagcaagt
tcttactcccccgcatctgccacgtctgtcattactaacggtgatagcagtaactcctat
ggactgagcagctccagcctgggcaggggaggttctggatttgcctgcaactcttacagc
agcggggactccgcttccctgtcccagcctggtctttgtggactcagtaaccttgggaat
acctgcttcatgaattctgcattacagtgtctgagtaatactcctcctctgactgactat
ttcctggaagataaatacgaagctgaaataaatcacagcaaccccttggggatgagagga
gaaattgcagaagcctatgcagaactcattaaacagatttggtctgggagacaatctcat
gtggccccacgtatgtttaaaacacaggttggccgatttgctcctcagttttcaggatac
cagcagcaagattcccaggagctcttggcttttcttcttgatggcttgcatgaggattta
aatagagtgaagaagaaaccttacttggagctgaaggatgccaatggcaggcctgattcg
gtggtagcaaaagaagcctgggagaaccacagactgcgaaacgattctatcattgtggat
atttttcatggtcttttcaaatctacccttgtttgtcccaaatgctctaaggtttctgtg
acctttgatcccttctgttacttaacccttccgctgcctttgaagagagatcgtctcctg
gaagttaccctggtacctgcggacccgcagcgcagacctgtccagtaccgggtcgtggtg
ccaatgatgggggccatctcagatctctgcgaatcgctctccaaactttctggggttcct
gcagaaaacatggtggtgacagatgtgtataaccatcggttccacaaaatcttccaggcg
gatgaaggtttaaatcatatcatgccaaaagacgacatctttgtatatgaagtctgcaag
ccaagtgaagatggctcagagtacattactttctctgtttactttcgggaaaaggcagcg
aggcaatccagcagcacttcagggaccatactctttggtcagccactgctgatatctgtg
ccaaaacacaagctcactgtagatcacttgtatggtgttgttttggagcggatcagtcgc
tatgtgaaactccctgtggcagaagaatactccacaccttgcccaggcagaggagcatgc
aatggctccagcagtgtggctgaaggtgacattgaagagatggagcatcaggatgatgga
caggaatgcagggagaagctggcagaagtggatccctgccactctgagggttgcatgcag
attgaaccaacgagagacgtgcagccttgtaagaagcagcatttcacttttagccttgtg
aatttatatgggacttctgagataaactccattgtagaaggaaaactcttgaaattgaat
gctttctctacacttgctattgactgggattctgatacgcggaggctgctctttgatgaa
caggaagcacaggcgtttgaaaagcatgcaagtgtgttacagccacagaagatgaaggca
gtggtagccctgaaagactgcatagagctctttactacaatggaaactcttggtgaacat
gacccttggtattgccctaactgtaagaagcatcagcaggccacgaagaagtttgacttg
tggtctttgcccaagattttggtagtgcatctaaaacgcttctcatacagcagatactgg
agggataaactcgacactgttgttgaattccctatcaggggtttaaacatgtccgagttc
gtctgtgacccaagaggaagctcgtatgtctacgacctcattgcagtttccaatcactat
ggagccatgggagtaggccactacactgcctatgcaaagaacaaggtgaatggcaagtgg
tactactttgatgacagcagtgtatcgttggcttcagaagaccaaatagtgacaaaagct
gcatatgtgctgttttatcagcgccgaaacagtgaggaacatgttgccccatctcctccc
caagaagagtgtgacggcatggataccaactaa

DBGET integrated database retrieval system