KEGG   Meleagris gallopavo (turkey): 100546721Help
Entry
100546721         CDS       T01523                                 

Definition
ubiquitin carboxyl-terminal hydrolase 4-like
Orthology
K11835  
ubiquitin carboxyl-terminal hydrolase 4/11/15 [EC:3.1.2.15]
Organism
mgp  Meleagris gallopavo (turkey)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
14
AA seq 917 aa AA seqDB search
MLLLDENQQKNKPSQCKHAAVPARYVGYDRWDVSGVGDPNLFPGPIDNACLLNDGESQSL
KEHLIAQLDYVLVPSSAWQKLVSWYGCIEGQQPIVRKVMEFGLYAKHCEVEVYPLELKLC
ESSSPSNVISCCFSRRDSVATLVKEIRKLFKIPAEKDVRLWSSHFDGSYEQLSELGVTLE
DANIYHGELVLIEVKNEDGMWPQHPFLAKSSTASSRNFTTSSKPSASSYSPASATSVITN
GDSSNSYGLSSSSLGRGGSGFACNSYSSGDSASLSQPGLCGLSNLGNTCFMNSALQCLSN
TPPLTDYFLEDKYEAEINHSNPLGMRGEIAEAYAELIKQIWSGRQSHVAPRMFKTQVGRF
APQFSGYQQQDSQELLAFLLDGLHEDLNRVKKKPYLELKDANGRPDSVVAKEAWENHRLR
NDSIIVDIFHGLFKSTLVCPKCSKVSVTFDPFCYLTLPLPLKRDRLLEVTLVPADPQRRP
VQYRVVVPMMGAISDLCESLSKLSGVPAENMVVADVYNHRFHKIFQADEGLNHIMPKDDI
FVYEVCKPSEDGSEYITFSVYFREKAARQSSSTSGTILFGQPLLISVPKHKLTVDHLYGV
VLERISRYVKLPVAEEYSTPCPGRGACNGSSSVAEGDIEEMEHQDDGQECREKLAEVDPC
HSEGCMQIEPTRDVQPCKKQHFTFSLVNLYGTSEINSIVEGKLLKLNAFSTLAIDWDSDT
RRLLFDEQEAQAFEKHASVLQPQKMKAVVALKDCIELFTTMETLGEHDPWYCPNCKKHQQ
ATKKFDLWSLPKILVVHLKRFSYSRYWRDKLDTVVEFPIRGLNMSEFVCDPRGSSYVYDL
IAVSNHYGAMGVGHYTAYAKNKVNGKWYYFDDSSVSLASEDQIVTKAAYVLFYQRRNSEE
HVAPSPPQEECDGMDTN
NT seq 2754 nt NT seq  +upstreamnt  +downstreamnt
atgctactcttggatgaaaatcagcagaaaaacaaaccatcccaatgtaagcatgctgca
gtcccagcacgctacgtgggttacgacaggtgggacgtgtccggcgtgggcgaccccaac
ctctttcctgggcccatcgacaacgcgtgtctgctgaacgatggggaaagtcagagctta
aaggagcacctcatcgcccagctggactacgtgctagtgcccagcagcgcctggcagaag
ctggtttcgtggtatggctgcatcgagggacagcagcccatcgtgaggaaagtgatggaa
tttggtctgtatgcaaagcactgtgaagttgaagtttatcctcttgagctgaagctgtgt
gagagcagcagtccttccaacgtgatcagctgctgcttcagcagaagagatagtgttgcc
actcttgtgaaagagattcggaaactatttaagatcccagctgagaaggatgtgaggtta
tggagcagccattttgatggctcctacgagcagctcagcgagctgggtgtcactctagaa
gatgcaaacatctatcatggggagcttgtcctaatagaagtgaaaaatgaagatggcatg
tggcctcaacatcctttccttgcaaagtcaagcactgcaagtagcagaaactttactacc
tcttcaaaaccttcagcaagttcttactcccccgcatctgccacgtctgtcattactaac
ggtgatagcagtaactcctatggactgagcagctccagcctgggcaggggaggttctgga
tttgcctgcaactcttacagcagcggggactccgcttccctgtcccagcctggtctttgt
ggactcagtaaccttgggaatacctgcttcatgaattctgcattacagtgtctgagtaat
actcctcctctgactgactatttcctggaagataaatacgaagctgaaataaatcacagc
aaccccttggggatgagaggagaaattgcagaagcctatgcagaactcattaaacagatt
tggtctgggagacaatctcatgtggccccacgtatgtttaaaacacaggttggccgattt
gctcctcagttttcaggataccagcagcaagattcccaggagctcttggcttttcttctt
gatggcttgcatgaggatttaaatagagtgaagaagaaaccttacttggagctgaaggat
gccaatggcaggcctgattcggtggtagcaaaagaagcctgggagaaccacagactgcga
aacgattctatcattgtggatatttttcatggtcttttcaaatctacccttgtttgtccc
aaatgctctaaggtttctgtgacctttgatcccttctgttacttaacccttccgctgcct
ttgaagagagatcgtctcctggaagttaccctggtacctgcggacccgcagcgcagacct
gtccagtaccgggtcgtggtgccaatgatgggggccatctcagatctctgcgaatcgctc
tccaaactttctggggttcctgcagaaaacatggtggtggcagatgtgtataaccatcgg
ttccacaaaatcttccaggcggatgaaggtttaaatcatatcatgccaaaagacgacatc
tttgtatatgaagtctgcaagccaagtgaagatggctcagagtacattactttctctgtt
tactttcgggaaaaggcagcgaggcaatccagcagcacttcagggaccatactctttggt
cagccactgctgatatctgtgccaaaacacaagctcactgtagatcacttgtatggtgtt
gttttggagcggatcagtcgctatgtgaaactccctgtggcagaagaatactccacacct
tgcccaggcagaggagcatgcaatggctccagcagtgtggctgaaggtgacattgaagag
atggagcatcaggatgatggacaggaatgcagggagaagctggcagaagtggatccctgc
cactctgagggttgcatgcagattgaaccaacgagagacgtgcagccttgtaagaagcag
catttcacttttagccttgtgaatttatatgggacttctgagataaactccattgtagaa
ggaaaactcttgaaattgaatgctttctctacacttgctattgactgggattctgatacg
cggaggctgctctttgatgaacaggaagcacaggcgtttgaaaagcatgcaagtgtgtta
cagccacagaagatgaaggcagtggtagccctgaaagactgcatagagctctttactaca
atggaaactcttggtgaacatgacccttggtattgccctaactgtaagaagcatcagcag
gccacgaagaagtttgacttgtggtctttgcccaagattttggtagtgcatctaaaacgc
ttctcatacagcagatactggagggataaactcgacactgttgttgaattccctatcagg
ggtttaaacatgtccgagttcgtctgtgacccaagaggaagctcgtatgtctacgacctc
attgcagtttccaatcactatggagccatgggagtaggccactacactgcctatgcaaag
aacaaggtgaatggcaagtggtactactttgatgacagcagtgtatcgttggcttcagaa
gaccaaatagtgacaaaagctgcatatgtgctgttttatcagcgccgaaacagtgaggaa
catgttgccccatctcctccccaagaagagtgtgacggcatggataccaactaa

DBGET integrated database retrieval system