KEGG   Meleagris gallopavo (turkey): 100546825Help
Entry
100546825         CDS       T01523                                 

Gene name
NLK
Definition
(RefSeq) nemo-like kinase
  KO
K04468  
nemo like kinase [EC:2.7.11.24]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
MAPK signaling pathway
FoxO signaling pathway
Wnt signaling pathway
Adherens junction
Brite
KEGG Orthology (KO) [BR:mgp00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    100546825 (NLK)
   04310 Wnt signaling pathway
    100546825 (NLK)
   04068 FoxO signaling pathway
    100546825 (NLK)
 Cellular Processes
  Cellular commiunity
   04520 Adherens junction
    100546825 (NLK)
Enzymes [BR:mgp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     100546825 (NLK)
Protein kinases [BR:mgp01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   100546825 (NLK)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
21
AA seq 316 aa AA seqDB search
MNRRYVVTELMQSDLHKIIVSPQPLSSDHVKVFLYQILRGLKYLHSAGILHRDIKPGNLL
VNSNCVLKICDFGLARVEELDESRHMTQEVVTQYYRAPEILMGSRHYSNAIDIWSVGCIF
AELLGRRILFQAQSPIQQLDLITDLLGTPSLEAMRTACEGAKAHILRGPHKQPSLPVLYT
LSSQATHEAVHLLCRMLVFDPSKRISAKDALAHPYLDEGRLRYHTCMCKCCFSTSTGRVY
TSDFEPITNPKFDDTFEKNLSSVRQVKEIIHQFILEQQKGNRVPLCINPQSAAFKSFISS
TVAQPSEMPPSPLVWE
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgaaccgcagatacgttgtcactgaactgatgcagagcgacctccataagattatcgtc
tctcctcagcctctcagctcggatcacgtcaaagtttttctttaccagattttaagaggt
ctgaaatacctacattctgctggcattttgcatcgagacattaaaccagggaacctactt
gtgaacagcaactgtgttcttaagatttgtgattttggattggccagggtggaagaatta
gatgaatctcgtcacatgactcaggaagttgtcactcagtattatcgggctccagaaatc
ctgatgggcagccgccactacagcaatgctattgacatctggtctgtaggctgcatcttt
gcagaattgctcgggcgaaggatattgtttcaggcacagagtcccattcagcagctggat
ctgatcacagacctgctgggaacgccctcactggaagcaatgaggacagcgtgcgaaggc
gccaaggcacacatactcaggggtcctcacaaacagccatcccttcctgtcctatataca
ctttccagtcaagctactcatgaagcagttcatctcctttgcagaatgttggtctttgat
ccatccaaaagaatatctgctaaggacgccttagctcacccataccttgatgaagggcgg
ttgcgataccacacctgtatgtgtaaatgctgtttttccacatccactggaagagtttat
actagtgattttgaacccatcactaatcccaaatttgatgacacttttgaaaagaacctc
agttctgttcggcaggttaaagaaataattcaccagttcattttggaacagcagaaagga
aacagagtacctctctgcatcaaccctcagtctgctgcttttaagagctttattagttcc
acagttgctcaaccttctgagatgccaccatctccactggtttgggagtga

DBGET integrated database retrieval system