KEGG   Meleagris gallopavo (turkey): 100546825Help
Entry
100546825         CDS       T01523                                 

Definition
serine/threonine-protein kinase NLK-like
Orthology
K04468  
nemo like kinase [EC:2.7.11.24]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
MAPK signaling pathway
FoxO signaling pathway
Wnt signaling pathway
Adherens junction
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway [PATH:mgp04010]
Environmental Information Processing; Signal transduction; Wnt signaling pathway [PATH:mgp04310]
Environmental Information Processing; Signal transduction; FoxO signaling pathway [PATH:mgp04068]
Cellular Processes; Cell communication; Adherens junction [PATH:mgp04520]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
21
AA seq 454 aa AA seqDB search
MFKRQEHGIIDEWLLLHASLLQKAPPSIVDGHSTLYEKILLYQILDGTVSKVNQHSQHPQ
QQLDIEPDRPIGYGAFGVVWSVTDPRDGKRVALKKMPNVFQNLVSCKRVFRELKMLCFFK
HDNVLSALDILQPPHIDYFEEIYVVTELMQSDLHKIIVSPQPLSSDHVKVFLYQILRGLK
YLHSAGILHRDIKPGNLLVNSNCVLKICDFGLARVEELDESRHMTQEVVTQYYRAPEILM
GSRHYSNAIDIWSVGCIFAELLGRRILFQAQSPIQQLDLITDLLGTPSLEAMRTACEGAK
AHILRGPHKQPSLPVLYTLSSQATHEAVHLLCRMLVFDPSKRISAKDALAHPYLDEGRLR
YHTCMCKCCFSTSTGRVYTSDFEPITNPKFDDTFEKNLSSVRQVKEIIHQFILEQQKGNR
VPLCINPQSAAFKSFISSTVAQPSEMPPSPLVWE
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
atgttcaagcgtcaagaacatggcatcattgatgagtggcttcttttacacgcttccctg
ctgcaaaaggctcctccttccatcgtggatggacattcaactctgtatgagaaaatcctg
ctttatcaaatacttgatggcacagtgagcaaagtgaatcagcactcacaacatccacag
cagcagctggatattgaaccggacagacctattggatacggagcctttggtgtcgtctgg
tcagtcacagatccgcgagacggaaagagagttgcactcaaaaagatgcccaacgtcttc
caaaatctggtctcttgtaaaagggtcttccgggagttgaagatgttgtgtttttttaag
catgacaatgtactctctgcccttgacatactccagcctccgcacattgactattttgaa
gaaatatacgttgtcactgaactgatgcagagcgacctccataagattatcgtctctcct
cagcctctcagctcggatcacgtcaaagtttttctttaccagattttaagaggtctgaaa
tacctacattctgctggcattttgcatcgagacattaaaccagggaacctacttgtgaac
agcaactgtgttcttaagatttgtgattttggattggccagggtggaagaattagatgaa
tctcgtcacatgactcaggaagttgtcactcagtattatcgggctccagaaatcctgatg
ggcagccgccactacagcaatgctattgacatctggtctgtaggctgcatctttgcagaa
ttgctcgggcgaaggatattgtttcaggcacagagtcccattcagcagctggatctgatc
acagacctgctgggaacgccctcactggaagcaatgaggacagcgtgcgaaggcgccaag
gcacacatactcaggggtcctcacaaacagccatcccttcctgtcctatatacactttcc
agtcaagctactcatgaagcagttcatctcctttgcagaatgttggtctttgatccatcc
aaaagaatatctgctaaggacgccttagctcacccataccttgatgaagggcggttgcga
taccacacctgtatgtgtaaatgctgtttttccacatccactggaagagtttatactagt
gattttgaacccatcactaatcccaaatttgatgacacttttgaaaagaacctcagttct
gttcggcaggttaaagaaataattcaccagttcattttggaacagcagaaaggaaacaga
gtacctctctgcatcaaccctcagtctgctgcttttaagagctttattagttccacagtt
gctcaaccttctgagatgccaccatctccactggtttgggagtga

DBGET integrated database retrieval system