KEGG   Meleagris gallopavo (turkey): 100546830Help
Entry
100546830         CDS       T01523                                 

Gene name
MAPK14
Definition
(RefSeq) mitogen-activated protein kinase 14
Organism
mgp  Meleagris gallopavo (turkey)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
28
AA seq 208 aa AA seqDB search
MSQERPKFYRQELNKTVWEVPERYQNLSPVGSGAYGSVCSAFDTKTGLRVAVKKLSRPFQ
SIIHAKRTYRELRLLKHMKHENVIGLLDVFTPAKSLEEFNDVYLVTHLMGADLNNIVKCQ
KLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMT
GYVATRWYRAPEIMLNWMHYNQTGNAFY
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atgtctcaggagcggcccaagttttaccgccaggagctcaacaagacggtgtgggaggtg
cccgagcgctaccaaaacctctccccggtcgggtccggggcctacggctccgtctgttct
gcctttgacacaaaaactgggttgcgagtggctgtaaagaagctgtcccggccatttcag
tctatcatccatgccaaaaggacctaccgagaactacggctactgaagcatatgaagcac
gaaaacgtgatcggcttgctggatgtgttcacccctgccaaatcgctagaagaattcaat
gatgtgtacttggtgacacacctcatgggagcagatctaaacaacattgtgaaatgccag
aaactcacagatgaccacgtgcagttccttatatatcagattcttcgggggctgaagtac
atccattcagctgacataatacacagagatttaaaacctagtaacttagctgtaaatgaa
gactgtgagctgaagatcctggattttggcttggctcgacacacagatgatgagatgact
gggtatgtggctacccggtggtacagggctcctgagatcatgttgaactggatgcattac
aaccagacaggtaatgcattttactaa

DBGET integrated database retrieval system