KEGG   Meleagris gallopavo (turkey): 100546861Help
Entry
100546861         CDS       T01523                                 

Gene name
TGFBR2
Definition
(RefSeq) transforming growth factor, beta receptor II (70/80kDa)
  KO
K04388  
TGF-beta receptor type-2 [EC:2.7.11.30]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
MAPK signaling pathway
Cytokine-cytokine receptor interaction
FoxO signaling pathway
Endocytosis
TGF-beta signaling pathway
Adherens junction
Module
TGF-beta signaling
Brite
KEGG Orthology (KO) [BR:mgp00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    100546861 (TGFBR2)
   04350 TGF-beta signaling pathway
    100546861 (TGFBR2)
   04068 FoxO signaling pathway
    100546861 (TGFBR2)
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100546861 (TGFBR2)
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    100546861 (TGFBR2)
  Cellular commiunity
   04520 Adherens junction
    100546861 (TGFBR2)
Enzymes [BR:mgp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     100546861 (TGFBR2)
Protein kinases [BR:mgp01001]
 Serine/threonine protein kinases: TKL group
  TGFBR2 family [OT]
   100546861 (TGFBR2)
Enzyme-linked receptors [BR:mgp01020]
 Receptor serine/threonine kinases
  Type II TGF-beta receptor
   100546861 (TGFBR2)
Cytokine receptors [BR:mgp04050]
 TGF-beta receptors
  Type II TGF-beta receptor
   100546861 (TGFBR2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
6
AA seq 537 aa AA seqDB search
MLEGYDTHRSKENGLQLPRLCKFCDIKATTCSNQYQCKSNCNITSICEKNNEVCAAVWRR
NDENVTLETICHDPQKRLYGHMLDDSSSEQCVMKEKKDDGGLMFMCSCTGEECNDVLIFS
ADDPHKPEEKDEISKVTIISLVPLLVISVAVIVIFYAYRTHKKRKLNKAWEKNVKPRKHK
DCSDVCAIMLDDDHSDISSTCANNINHNTELLPIELDIVVGKGRFAEVYKAKLKQNTSEQ
YETVAVKIFPYEEYASWKTEKDIFSDVNLKHENILQFLTAEERKTDLGKQYWLITAFHAR
GNLQEYLTRHIISWEDLWKLGGSLARGIAHLHSDHTPCGRPKTPIVHRDLKSSNILVKND
LTCCLCDFGLSLRLDPSLSVDDLANSGQVGTARYMAPEVLESRMNLENMESFKQTDVYSM
ALVLWEMTSRCNGVGEVKEYEPPFGSKVREHPCVESMKDNVLRDRGRPEIPSSWLNHQGI
QMVCETLIECWDHDPEARLTAQCVAERFSEFKHHDKLSGRSCSEEKIPEDGSVTTAK
NT seq 1614 nt NT seq  +upstreamnt  +downstreamnt
atgctcgagggttatgatacacatagaagcaaggaaaatggactgcaattgcccaggctg
tgcaaattctgtgacattaaagcaacgacgtgctcaaaccagtatcagtgcaagagcaac
tgcaacatcacttctatctgtgagaagaataacgaagtctgtgcggctgtatggagacgg
aacgatgaaaatgtgacattagaaacaatctgccacgatccccagaaaagactgtatggt
cacatgttggatgactccagctcagagcagtgtgtgatgaaggagaagaaggatgatggg
ggactgatgttcatgtgctcctgtacaggtgaagagtgcaacgatgttcttattttttct
gcagatgatccccataagccagaggagaaagatgaaatttccaaagtcacaatcataagt
cttgtccccttgttggtgatttctgttgctgtgattgttatcttttatgcctaccgcact
cataagaagaggaagctcaacaaggcctgggagaagaatgttaagcccaggaaacataaa
gactgcagtgatgtttgtgccattatgttggatgatgatcactcagacatcagctctacc
tgtgccaacaacatcaaccacaacacagaattgctgcccattgagctggacattgttgtt
ggcaaaggaagatttgctgaagtgtataaagcaaaattgaagcaaaacacatctgagcag
tatgaaactgtggcagtaaagatcttcccctatgaagaatatgcctcctggaaaaccgag
aaagacattttttcggatgtaaaccttaagcatgagaacatcctccaattcttgactgca
gaggagcgtaagacagatcttggtaaacagtattggttgatcactgccttccatgctagg
ggaaacttgcaggaatacctcacacggcacattatcagctgggaagacctctggaaactg
ggaggatccttggcccgagggattgcccatctgcacagtgatcacacaccctgtggtcgt
cctaaaacccctattgtgcacagagacctaaagagttccaacatcctggtgaaaaatgat
ttaacttgctgtctctgtgactttgggttatccctcaggctggacccttctctctctgtg
gatgacttggccaacagcggtcaggttggcacagcaaggtacatggcccctgaggtcctg
gagtccaggatgaaccttgagaacatggagtcctttaaacaaacagatgtgtactccatg
gctttggtcctttgggaaatgacatctcgctgtaatggtgttggagaagtgaaagagtat
gagcctcccttcggctctaaagtgcgggaacatccctgcgtggaaagcatgaaggacaat
gtcctaagagacagagggcgacctgagatccccagctcctggcttaaccatcagggcatc
cagatggtgtgtgagacccttatcgagtgctgggaccacgaccccgaggctcggctcacg
gcgcagtgcgtggcggagcgcttcagtgagttcaagcaccacgacaagctctcagggaga
agctgttcagaggagaagatccccgaggacggctccgtgaccactgccaagtag

DBGET integrated database retrieval system