KEGG   Meleagris gallopavo (turkey): 100546933Help
Entry
100546933         CDS       T01523                                 

Definition
(RefSeq) phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit gamma isoform-like
  KO
K00922  
phosphatidylinositol-4,5-bisphosphate 3-kinase [EC:2.7.1.153]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
Inositol phosphate metabolism
ErbB signaling pathway
FoxO signaling pathway
Phosphatidylinositol signaling system
mTOR signaling pathway
Apoptosis
Adrenergic signaling in cardiomyocytes
VEGF signaling pathway
Focal adhesion
Toll-like receptor signaling pathway
Jak-STAT signaling pathway
Regulation of actin cytoskeleton
Insulin signaling pathway
Progesterone-mediated oocyte maturation
Influenza A
Module
PI3K-Akt signaling
Brite
KEGG Orthology (KO) [BR:mgp00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100546933
 Environmental Information Processing
  Signal transduction
   04012 ErbB signaling pathway
    100546933
   04370 VEGF signaling pathway
    100546933
   04630 Jak-STAT signaling pathway
    100546933
   04068 FoxO signaling pathway
    100546933
   04070 Phosphatidylinositol signaling system
    100546933
   04150 mTOR signaling pathway
    100546933
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    100546933
  Cell growth and death
   04210 Apoptosis
    100546933
  Cellular commiunity
   04510 Focal adhesion
    100546933
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    100546933
  Endocrine system
   04910 Insulin signaling pathway
    100546933
   04914 Progesterone-mediated oocyte maturation
    100546933
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100546933
 Human Diseases
  Infectious diseases
   05164 Influenza A
    100546933
Enzymes [BR:mgp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     100546933
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
1
AA seq 464 aa AA seqDB search
MNGEIDSGEKAVIRQLLSDGNTFIAVFVQVDVLNAVYSNSSDKSIHKAGVRYHWEESDKI
KVLGFIILNRSADCELVMPTAAFTYTAARFQLKNFYGTCDNLLREHREIILNLDDCVFLF
AIAVIAQLRQKLEKLQGSKLPESFRVPYDPGLRAGALVIEKCKVMASKKKPLWLEFKCAD
PTALSNETIGIIFKHGDDLRQDMLILQILRIMESIWEAESLDLCLLPYGCISTGNKIGMI
EIVKDATTIAKIQQSTVGNTGAFKDEILNQWLKDRCVIEEKFQAAVERFVYSCAGYCVAT
FVLGIGDRHNDNIMITETGNLFHIDFGHILGNYKSFLGINKERVPFVLTPDFLFVMGTSG
KKTSLHFHKFQDVCVKAYLALRHHTNLLIILFSMMLMTGMPQLTSKEDIEYIRDALTVGK
SEEDAKKHFLDQIEVCRDKGWTVQFNWFLHLVLGIKQGVEKHSA
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgaatggtgaaatagacagtggggaaaaggcagtgattagacagttattgagtgatgga
aatacttttattgcagtctttgtgcaagttgatgttttgaatgctgtgtattctaactcc
agtgataaatcgattcacaaggcgggcgtcaggtaccattgggaagaaagtgacaagata
aaagttttgggcttcattattttgaacagatctgcagactgtgaattagtcatgcccaca
gcagcatttacatatactgctgctagatttcagctgaaaaatttctacggaacatgtgac
aacctactaagggaacacagagaaattatactgaatttagatgattgtgttttcttgttt
gcaattgcagttattgcacaacttagacaaaaacttgaaaaactacaaggcagcaaactt
ccagaaagttttagagtcccgtatgaccctgggctaagagcaggagccctagtgatagaa
aaatgtaaagtaatggcatccaagaagaagcccctctggcttgagtttaaatgtgcagat
ccaactgctctatcaaatgaaaccataggcatcatctttaaacacggagatgacctccgt
caggacatgcttattttacagattcttcgaattatggaatccatttgggaagcagaatcc
ttggacctctgtttgctaccatatggctgtatttctacagggaacaaaataggaatgatt
gaaattgtgaaagatgctacaacaattgccaaaattcagcagagtacagttggaaacact
ggtgcatttaaggatgaaatactgaaccagtggctcaaggacagatgtgtcattgaggag
aagtttcaggcagctgtggaaaggtttgtttattcctgtgctggctactgtgtggcaacc
tttgttcttggaataggagacagacacaatgataacattatgatcacagaaacaggtaac
ctttttcatattgattttggccatattcttgggaattataaaagcttccttggaattaat
aaggaaagagttccttttgtgctgactccggattttctgtttgtcatggggacctccgga
aagaagacaagtctccatttccacaaatttcaggatgtgtgtgtgaaggcttatttagct
ctgcgacatcacaccaacctgctcatcatcctgttctccatgatgctaatgactggaatg
ccccagttaaccagcaaagaggatattgaatatatccgggatgcgctgacggtagggaaa
agcgaagaagatgctaaaaagcatttccttgatcagattgaggtttgcagagataagggc
tggactgtgcaatttaactggttcttacatcttgtgcttggaatcaagcaaggagtagaa
aagcattctgcttaa

DBGET integrated database retrieval system