KEGG   Meleagris gallopavo (turkey): 100546933Help
Entry
100546933         CDS       T01523                                 

Definition
(RefSeq) phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit gamma isoform-like
Organism
mgp  Meleagris gallopavo (turkey)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Ensembl: 
Position
1
AA seq 300 aa AA seqDB search
MASKKKPLWLEFKCADPTALSNETIGIIFKHGDDLRQDMLILQILRIMESIWEAESLDLC
LLPYGCISTGNKIGMIEIVKDATTIAKIQQSTVGNTGAFKDEILNQWLKDRCVIEEKFQA
AVERFVYSCAGYCVATFVLGIGDRHNDNIMITETGNLFHIDFGHILGNYKSFLGINKERV
PFVLTPDFLFVMGTSGKKTSLHFHKFQDVCVKAYLALRHHTNLLIILFSMMLMTGMPQLT
SKEDIEYIRDALTVGKSEEDAKKHFLDQIEVCRDKGWTVQFNWFLHLVLGIKQGVEKHSA
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atggcatccaagaagaagcccctctggcttgagtttaaatgtgcagatccaactgctcta
tcaaatgaaaccataggcatcatctttaaacacggagatgacctccgtcaggacatgctt
attttacagattcttcgaattatggaatccatttgggaagcagaatccttggacctctgt
ttgctaccatatggctgtatttctacagggaacaaaataggaatgattgaaattgtgaaa
gatgctacaacaattgccaaaattcagcagagtacagttggaaacactggtgcatttaag
gatgaaatactgaaccagtggctcaaggacagatgtgtcattgaggagaagtttcaggca
gctgtggaaaggtttgtttattcctgtgctggctactgtgtggcaacctttgttcttgga
ataggagacagacacaatgataacattatgatcacagaaacaggtaacctttttcatatt
gattttggccatattcttgggaattataaaagcttccttggaattaataaggaaagagtt
ccttttgtgctgactccggattttctgtttgtcatggggacctccggaaagaagacaagt
ctccatttccacaaatttcaggatgtgtgtgtgaaggcttatttagctctgcgacatcac
accaacctgctcatcatcctgttctccatgatgctaatgactggaatgccccagttaacc
agcaaagaggatattgaatatatccgggatgcgctgacggtagggaaaagcgaagaagat
gctaaaaagcatttccttgatcagattgaggtttgcagagataagggctggactgtgcaa
tttaactggttcttacatcttgtgcttggaatcaagcaaggagtagaaaagcattctgct
taa

DBGET integrated database retrieval system