KEGG   Meleagris gallopavo (turkey): 100546973Help
Entry
100546973         CDS       T01523                                 

Gene name
PPP1CC
Definition
(RefSeq) protein phosphatase 1, catalytic subunit, gamma isozyme
  KO
K06269  
serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
mRNA surveillance pathway
Oocyte meiosis
Adrenergic signaling in cardiomyocytes
Vascular smooth muscle contraction
Focal adhesion
Regulation of actin cytoskeleton
Insulin signaling pathway
Herpes simplex infection
Brite
KEGG Orthology (KO) [BR:mgp00001]
 Genetic Information Processing
  Translation
   03015 mRNA surveillance pathway
    100546973 (PPP1CC)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    100546973 (PPP1CC)
  Cell growth and death
   04114 Oocyte meiosis
    100546973 (PPP1CC)
  Cellular commiunity
   04510 Focal adhesion
    100546973 (PPP1CC)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    100546973 (PPP1CC)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100546973 (PPP1CC)
   04270 Vascular smooth muscle contraction
    100546973 (PPP1CC)
 Human Diseases
  Infectious diseases
   05168 Herpes simplex infection
    100546973 (PPP1CC)
Enzymes [BR:mgp01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     100546973 (PPP1CC)
Protein phosphatases and associated proteins [BR:mgp01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    Catalytic subunits
     100546973 (PPP1CC)
Transcription machinery [BR:mgp03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Transcription termination factor
     100546973 (PPP1CC)
Messenger RNA biogenesis [BR:mgp03019]
 Eukaryotic Type
  mRNA processing factors
   3' end processing
    Cleavage and polyadenylation specificity factor (CPSF) complex
     100546973 (PPP1CC)
Spliceosome [BR:mgp03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    100546973 (PPP1CC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
17
AA seq 349 aa AA seqDB search
MKQLNNIQRGNLNGLRGEFPLKHNATPRFMQEGATTGRADPVPPVRGSKPGKNVQLQENE
IRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYV
DRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTD
CFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVL
GWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCG
EFDNAGAMMSVDETLMCSFQILKPAEKKKPNASRPVTPPRSMITKQAKK
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgaagcaattaaacaacattcagagaggcaacttgaacggcctgcgtggtgaatttccc
ttgaaacacaacgcaacgcctcgcttcatgcaggagggagccacgacggggcgtgcagac
cccgtaccaccggtgagaggatcaaaaccaggtaaaaatgtccaacttcaagagaatgaa
atcagaggactgtgcttgaaatccagagaaatttttctcagtcagcctattctgctcgaa
cttgaagctccactgaaaatatgtggtgacatccatggacaatactatgacttgcttcgg
ctctttgaatatggaggctttccaccagaaagcaactacctattccttggtgactatgtt
gacagaggaaagcagtctttagaaacaatttgtcttctattggcctacaaaattaaatat
ccagagaactttttccttctcagagggaaccatgaatgtgccagcattaatagaatttat
ggattttatgatgaatgtaagagaagatacaatattaagctgtggaaaaccttcacagat
tgttttaactgtttaccaattgcagcaattgtggatgagaagatattctgctgtcatgga
ggtttgtcaccagacctgcagtcgatggaacagatcagacgaattatgcgccccactgat
gtacctgaccaaggtcttctttgtgatctcctgtggtctgaccctgacaaagatgtctta
ggatggggtgaaaacgacagaggagtgtcctttacttttggagctgaagtggttgctaag
tttctccataaacatgatttggatctcatatgtagagctcatcaggttgtggaagatgga
tatgagttttttgcaaaaagacaattggtaactctcttttctgccccgaattactgtgga
gaatttgataatgcaggtgccatgatgagtgtggatgaaaccttaatgtgttcttttcag
attttgaaacccgcagagaagaagaagcccaacgctagcagacctgtaacacctcccagg
agtatgatcacaaagcaagcaaagaaatag

DBGET integrated database retrieval system