KEGG   Meleagris gallopavo (turkey): 100547037Help
Entry
100547037         CDS       T01523                                 

Gene name
MTOR
Definition
mechanistic target of rapamycin (serine/threonine kinase)
Orthology
K07203  
FKBP12-rapamycin complex-associated protein
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
ErbB signaling pathway
mTOR signaling pathway
Insulin signaling pathway
Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:mgp00001]
 Environmental Information Processing
  Signal transduction
   04012 ErbB signaling pathway
    100547037 (MTOR)
   04150 mTOR signaling pathway
    100547037 (MTOR)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    100547037 (MTOR)
   04920 Adipocytokine signaling pathway
    100547037 (MTOR)
Protein kinases [BR:mgp01001]
 Serine/threonine protein kinases: Atypical group
  PIKK family [OT]
   100547037 (MTOR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
23
AA seq 2521 aa AA seqDB search
MSGTVSILQQFANGLKSRSEETRAKAAKDLQHYVTMELREMSQEESTRFYDQLNHHIFEL
VSSSDANERKGGILAIASLIGVEGGNATRIGRFANYLRNLLPSNDPVVMEMASKAIGRLA
MAGDTFTAEYVEFEVKRALEWLGADRNEGRRHAAVLVLRELAISVPTFFFQQVQPFFDNI
FVAVWDPKQAIREGAVSALRACLILTTQREPKEMQKPQWYRHTYEEAEKGFDETLAKEKG
MNRDDRIHGALLILNELVRISSMEGERLREEMEEITQQQLVHDKYCKDLMGFSTKPRHIT
PFTSFQSLQPSQSNALAGLLGYNAHQGIMGFATSPVPAKSTLVESRCCRDLMEEKFDQVC
QWVLKCRTSKNSLIQMTVLNLLPRLAAFRPSAFTADQYLPDTMNHVLSCVKKEKERTAAF
QALGLLSVAVRSEFQAYLPKVLEIIKAALPPKDFAHKRQKSVQVDATVFTCISMLARAMG
PSIQQDIKELLEPMLAVGLSPALTAVLYDLSRQIPQLKKDIQDGLLKMLSLVLMHKPLRH
PGMPKGLAHQLASPSLTNIPEASDVGSITLALRTLGSFEFEGHSLTQFVRHCADHFLNSE
HKEIRMEAARTCSRLLTPSIHLISGHAHVVSQTAVQVVADVLSKLLVVGITDPDPDIRFC
VLASLDERFDAHLAQAENLQALFVALNDQVFEIRELAICTVGRLSSMNPAFVMPFLRKML
IQILTELEHSGVGRIKEQSARMLGHLVSNAPRLIRPYMEPILKALIVKLKDPDPDPNPGV
INNVLATIGELAQVSGLEMRKWVDELFIIIMDMLQDSSLLAKRQVALWTLGQLVASTGYV
VEPYRKYPTLLEVLLNFLKTEQNQGTRREAIRVLGLLGALDPYKHKVNIGMIDQSRDASA
VSLSESKSSQDSSDYSTSEMLVNMGNLPLDEFYPAVSMVALMRIFRDQSLSQHHTMVVQA
ITFIFKSLGLKCVQFLPQVMPTFLNVIRVCDGAIREFLFQQLGMLVSFVRSHIRPYMDEI
VTLMRDFWVMNNSIQSTIILLIEQIVVALGGEFKLYLPQLIPHMLRVFMHDNSQSRIVSV
KLLNAIQLFGANLDDYLHLLLPPIVKLFDAPDAPVVARKAALETVDRLTESLDFTDYASR
IIHPIVRTLDQSPELRTTAMDTLSSLVFQLGKKYQIFIPMVNKVLVRHRINHQRYDVLIC
RIVKGYTLADEEEDPLIYQHRMLRSNQGETLASGPVETGPMKKLHVSTINLQKAWGAARR
VSKDDWLEWLRRLSLELLKDSSSPSLRSCWALAQAYNPMARDLFNAAFVSCWSELNEDQQ
DELIRSIELALTSQDIAEVTQTLLNLAEFMEHSDKGPLPLRDDNGIVLLGERAAKCRAYA
KALHYKELEFQKGPTPAILESLISINNKLQQPEAAAGVLEYAMKHFGELEIQATWYEKLH
EWEDALVAYDKKMDTNKDDPELMLGRMRCLEALGEWGQLHQQCCEKWTQVNDETQAKMAR
MAAAAAWGLGQWDSMEEYTCMIPRDTHDGAFYRAVLALHQDLFSLAQQCIDKARDLLDAE
LTAMAGESYSRAYGAMVSCQMLSELEEVIQYKLVPERREIIRQIWWERLQGCQRIVEDWQ
RILMVRSLVVNPHEDMRTWLKYASLCGKSGRLALAHKTLVLLLGVDPSRQLDHPLPTVHP
QVTYAYMKHMWKSARKIDAFQHMQHFVQTMQQQAQHAIATEDQQHKQELHKLMARCFLKL
GEWQLNLQGINESTIPKVLQYYSAATEHDRNWYKAWHAWAVMNFEAVLHYKHQNQARDEK
KKLRHASGASITSANTEGSNSESDAESTENSPIPSPVQKKVTEDLSKTLLMYTVPAVQGF
FRSISLSRGNNLQDTLRVLTLWFDYGHWPDVNEALVEGVKAIQIDTWLQVIPQLIARIDT
PRPLVGRLIHQLLTDIGRYHPQALIYPLTVASKSTTTARHNAANKILKNMCEHSNTLVQQ
AMMVSEELIRVAILWHEMWHEGLEEASRLYFGERNVKGMFEVLEPLHAMMERGPQTLKET
SFNQAYGRDLMEAQEWCRKYMKSGNVKDLTQAWDLYYHVFRRISKQLPQLTSLELQYVSP
KLLMCRDLELAVPGTYDPNQPIIRIQSIAPSLQVITSKQRPRKLTLMGSNGHEFVFLLKG
HEDLRQDERVMQLFGLVNTLLANDPTSLRKNLSIQRYAVIPLSTNSGLIGWVPHCDTLHA
LIRDYREKKKILLNIEHRIMLRMAPDYDHLTLMQKVEVFEHAVNNTAGDDLAKLLWLKSP
SSEVWFDRRTNYTRSLAVMSMVGYILGLGDRHPSNLMLDRLSGKILHIDFGDCFEVAMTR
EKFPEKIPFRLTRMLTNAMEVTGLDGNYRITCHTVMEVLREHKDSVMAVLEAFVYDPLLN
WRLMDTNTKGNKRSRTRTDSYSASQSVEMLDGMELGETAHKKTGTTVPESIHSFIGDGLV
KPEALNKKAIQIINRVRDKLTGRDFSHDETLDVPTQVELLIKQATSHENLCQCYIGWCPF
W
NT seq 7566 nt NT seq  +upstreamnt  +downstreamnt
atgtcaggcactgtgtctattctccaacaatttgccaatggcttgaagagtcgcagtgaa
gaaacaagggcgaaagctgccaaggacctgcagcattatgtcaccatggaactccgtgaa
atgagccaggaggaatccaccaggttttatgatcagctgaaccatcacatttttgaactg
gtctctagctctgatgcaaatgaaaggaagggtggcattttggctatagcaagccttatt
ggtgtagaaggaggtaacgccacccgtatcggcaggtttgcaaactatctgaggaacctt
ttgccatccaatgacccagttgtaatggaaatggcttccaaggctatcgggcgacttgca
atggctggtgacaccttcacagctgagtatgtggagtttgaggtgaaacgtgctctggaa
tggctgggggctgacaggaatgaaggtcgaagacatgcagctgttcttgttctgcgtgag
ctggcaatcagtgtgcctaccttcttcttccaacaagtgcagccgttctttgacaatatt
tttgtggctgtgtgggatcccaaacaggccattcgagagggagccgtttctgccttaaga
gcctgccttatcctcaccactcagcgggaaccaaaagaaatgcagaaacctcagtggtac
agacatacatatgaagaggctgagaagggttttgatgaaactttggccaaggagaaagga
atgaaccgtgatgaccgaatccatggtgccttattgatcctcaatgagctcgtgaggatc
agcagtatggagggagagcgccttagagaggagatggaggagatcactcagcagcagctt
gtgcatgacaagtactgcaaagacctgatgggctttagtaccaaacctcgccacatcact
cccttcactagcttccagtctcttcagccctctcagtcaaatgctttggctggtcttctg
ggttacaatgcccaccaaggaatcatgggttttgcaacttcacctgtgccagcaaagtct
accttggtagaaagtcgatgctgcagggatctaatggaggaaaagtttgatcaggtgtgc
cagtgggttcttaagtgcagaaccagcaaaaactctttgatccagatgacagttctcaat
ctgctcccacggctggcggctttccgtccttcagcattcacagctgatcagtatcttcca
gacaccatgaaccatgttctcagctgtgtgaagaaggagaaggagagaacagcagccttc
caggccttgggtttgctttctgtggctgtcagatctgagtttcaagcttacctgccaaaa
gtccttgaaataataaaagcagctcttccaccaaaggactttgctcacaagaggcagaag
tctgtgcaggttgatgctacagtcttcacctgcattagtatgttggcacgagccatggga
ccaagtatccagcaggacattaaagagcttctggaacctatgctggctgtgggtctgagc
cctgctctaacagctgtgctgtacgacttgagtcgtcagatcccccagctaaagaaggat
atccaggatgggctgctgaaaatgctttcccttgttttaatgcacaaacctctgcgacat
ccaggcatgccaaaaggtcttgcccatcagctggcctcccctagcctcaccaacatccca
gaggccagtgatgtgggtagcatcacacttgccctacgtacgctgggcagctttgagttt
gaagggcattctctgactcagtttgtccggcattgtgcagaccactttctgaacagtgag
cacaaggagatacggatggaagcagcccgcacttgctctcgcttgctcacgccttccatc
cacttgatcagtggccatgcccacgtggtcagtcagacagcagtgcaggttgtggctgat
gttctcagcaaactgcttgtggttggaataacagacccagaccctgatatacgtttctgt
gtattggcatctctggatgagcgatttgatgctcaccttgcccaggcagaaaacttgcaa
gctctttttgtggccctgaatgatcaagtatttgaaatccgagagctcgccatctgtact
gtgggtcgcctgagcagcatgaaccccgcctttgtcatgcctttcctgcgcaagatgtta
atccagattctaacagaactagaacacagtggtgttggtaggattaaagagcaaagtgcc
aggatgttgggtcatctggtttctaatgctccacgcctcattcgtccatatatggagcct
atcctgaaggcactgattgtgaaactgaaagatcctgatccagatccaaatccaggggtg
attaacaacgttttagctaccataggggaacttgcacaggtcagtgggctggagatgagg
aagtgggtggatgaactcttcattataattatggacatgctacaggactcttccctgctg
gctaaaagacaagtggctctttggacactgggtcagcttgtggctagcactggttatgtg
gtggaaccatacaggaagtacccaactttactggaggtgcttctgaacttcctgaagact
gagcagaaccagggcacccgtagagaggctattcgtgtgttggggctgctgggtgctttg
gacccctacaaacacaaggtgaacattggcatgattgatcagtcacgagatgcttctgct
gtcagcctctcagagtccaaatctagccaggattcttcggattacagtaccagtgagatg
ctggtgaacatgggaaacctccctctggatgaattctatccagctgtctctatggtggca
ctgatgagaattttccgagaccagtccttgtcccagcaccacacaatggtggttcaggcc
atcacctttattttcaaatctcttggactgaagtgtgtgcagttcctgccccaggtcatg
ccaacgttccttaatgtaataagggtctgtgatggtgccatccgagagttcctgttccag
cagctggggatgttggtgtcctttgtgagaagccacattcggccctatatggatgaaatt
gtcaccctcatgagagacttctgggtcatgaacaactccatacagagcacaattatccta
cttattgagcaaattgtggtggctctaggaggcgagttcaagctctatctgcctcagctc
attcctcacatgttacgggtcttcatgcatgacaatagtcagagtcgaatcgtctctgtc
aagctattgaatgcaatccagctctttggagctaacctggatgactaccttcatttatta
ctacctcccattgtaaagctgtttgatgccccagatgccccagtggtggctcgcaaggct
gctcttgaaacggtggaccgcttgacagagtctctggattttaccgattatgcttcacga
attattcatcctattgtgagaacactggatcagagcccagagctacgaacaactgcaatg
gacactctctcctctctggtattccagctgggaaagaagtaccagatctttatcccgatg
gtaaacaaagttctggtgcgacacagaattaaccatcaacgctacgatgttcttatctgc
agaatcgtaaagggctacactcttgctgatgaagaggaggatcccctgatttatcaacat
cggatgttgagaagcaaccagggagaaactttggccagtggtcctgtggaaacaggtcct
atgaagaaattacatgttagcaccatcaacctgcagaaggcctggggagcagcaagaaga
gtctccaaagatgactggttggaatggttaagaagactcagtctggagctgctgaaagat
tcctcctcaccatccttgcgctcatgctgggccctggctcaggcatataatcctatggct
cgtgatctcttcaatgctgcttttgtttcatgttggtctgaactgaacgaagaccagcag
gatgagttgatccgaagcattgaattggctctgacttctcaggacattgcagaggtcact
cagacactgctgaacttggcagaattcatggaacacagcgacaagggtccactgcctttg
agagatgataatggcattgtccttctgggggagagagcagcaaagtgccgagcatatgcc
aaggctcttcactacaaggagctggaatttcagaagggccccactccagccattctagag
tctcttatcagcattaacaataaactgcaacagccagaagcagctgctggggtgctggaa
tatgccatgaaacactttggggagctggaaattcaagctacctggtatgaaaaacttcat
gaatgggaagatgctctggtggcctatgacaagaagatggacacaaacaaagatgatcct
gagctgatgctaggacgaatgcgttgcttggaagcacttggagaatggggccaactccac
cagcaatgctgtgagaagtggacgcaggtcaatgatgaaactcaagctaagatggcaagg
atggctgctgctgctgcctggggtctaggtcagtgggacagcatggaagaatatacctgc
atgatcccaagggacacccacgatggtgccttctacagggctgtactggctcttcatcag
gaccttttctcactggctcagcagtgcattgacaaggccagagatctgctcgatgctgag
ctgactgccatggcaggcgagagctacagtcgagcctatggagctatggtatcctgccag
atgctgtcagagctggaagaagttatccagtataaacttgtaccagaacgtcgtgagatc
atccgccagatatggtgggaaagactgcagggctgtcaacggattgtggaagactggcaa
agaatattgatggttaggtctcttgttgtgaatcctcacgaggacatgagaacttggctt
aagtatgccagcttgtgtggcaagagtgggagactggctttggcccataagacacttgtc
ctgctcttgggagtagatccatcccgacagctggatcacccactgccaacagtacatccc
caagtgacttatgcatacatgaaacacatgtggaagagcgcccgtaagatcgatgcattc
cagcacatgcagcacttcgtacagacgatgcagcagcaggcacagcatgctattgccact
gaggaccagcagcacaagcaagaactccacaagcttatggcacggtgtttcctgaaactg
ggtgagtggcagctgaacctgcaaggcatcaatgagagtaccatccccaaagtcttacag
tactacagtgctgcaacagagcacgatcgcaactggtacaaggcctggcacgcctgggca
gtgatgaattttgaagcagtgcttcactacaaacatcagaaccaggccagagatgagaag
aagaaattgcgtcatgccagtggtgccagtatcaccagtgccaacactgagggcagcaac
agtgagagtgatgcagagagcacagagaacagtcccatcccatctccagtgcagaaaaaa
gtcactgaggatttatccaagaccctcttgatgtacacagtccctgctgtccaaggcttc
ttcagatccatatctctgtctcgtggaaacaacctgcaagacactctcagagtccttact
ctatggtttgattatggtcactggcctgatgtgaatgaagctttggttgaaggggtcaag
gcaatccaaatagatacttggttgcaggttatccctcagcttattgcaagaattgacacc
cctcgaccattagtaggacgtctcattcatcagctcctcacagatattggacggtaccac
ccccaggctttgatctatcctttgactgtggcatctaaatccacgaccactgctcgccac
aatgctgcaaataaaatcttgaaaaacatgtgtgagcacagtaacacactggtgcagcag
gcaatgatggtaagtgaagagctaatccgtgtggcgatcctgtggcatgagatgtggcat
gaagggttggaagaagcatctcgtctgtacttcggagaaagaaatgtgaagggaatgttt
gaggtgctggaaccacttcatgctatgatggagcgtgggcctcagactttaaaagagaca
tccttcaatcaggcctatggcagagatctaatggaagctcaagagtggtgcaggaagtat
atgaaatcaggaaatgtcaaggacctaacccaggcttgggatctctattaccacgttttc
aggcgtatctcaaagcagttgcctcagctcacttctttggaactacagtacgtgtcacca
aaactcttaatgtgccgggacctggagttggcagtgccaggaacatatgatcccaaccag
cccatcatccgcattcagtccattgcaccctcacttcaggtcatcacctccaagcagcgg
cccaggaaactaacattaatgggaagcaatgggcatgagtttgtgttccttctgaaaggt
catgaagaccttcgtcaagatgaaagagtgatgcagctttttgggttggtcaacactctg
ctagcaaacgacccaacttctcttcgtaaaaacctcagcattcagagatacgctgttatt
ccactgtccacaaattcaggcttgataggttgggtcccccactgtgacacactgcatgcc
ctcattcgagactacagagagaagaagaagatcctgctgaacatcgaacatcgcatcatg
ctgaggatggctccagattatgaccacctgactttaatgcagaaggtagaagtatttgaa
catgctgtcaataacacagctggtgatgaccttgccaaactgctgtggttgaaaagtcca
agctcagaggtatggtttgacagaagaacaaactacactcgttcactggctgtgatgtca
atggttgggtacattttgggtcttggggacagacacccttccaatctgatgttagacaga
ctgagtggaaaaatcctgcatatcgactttggggactgttttgaggttgcaatgacaaga
gagaagttccctgagaagatcccatttcggttaacaaggatgctgacaaacgctatggag
gtgacgggccttgatggcaattacagaatcacctgccacacagtgatggaagtcctgcgt
gagcataaggacagtgtcatggctgtgctggaagcctttgtgtatgatccattattgaac
tggaggctgatggacacaaatacaaagggcaataaacgctcacgaacaagaacagactcc
tactcagccagccagtcagtagaaatgttagatggtatggaactgggggagacagcccat
aagaaaactgggaccacagtgcctgaatccatccattccttcataggagatggcctcgtg
aagccagaagctctaaataagaaagcaattcaaattatcaacagagttcgagataaactc
actggtcgagacttctctcatgatgaaacacttgatgtacccacacaagtagaattgctc
attaagcaggctacttctcatgagaatctgtgccagtgctacattggatggtgtcctttc
tggtaa

DBGET integrated database retrieval system