KEGG   Meleagris gallopavo (turkey): 100547037Help
Entry
100547037         CDS       T01523                                 

Gene name
MTOR
Definition
(RefSeq) mechanistic target of rapamycin
  KO
K07203  serine/threonine-protein kinase mTOR [EC:2.7.11.1]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
mgp04012  ErbB signaling pathway
mgp04136  Autophagy - other
mgp04140  Autophagy - animal
mgp04150  mTOR signaling pathway
mgp04218  Cellular senescence
mgp04371  Apelin signaling pathway
mgp04910  Insulin signaling pathway
mgp04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:mgp00001]
 Environmental Information Processing
  Signal transduction
   04012 ErbB signaling pathway
    100547037 (MTOR)
   04371 Apelin signaling pathway
    100547037 (MTOR)
   04150 mTOR signaling pathway
    100547037 (MTOR)
 Cellular Processes
  Transport and catabolism
   04140 Autophagy - animal
    100547037 (MTOR)
   04136 Autophagy - other eukaryotes
    100547037 (MTOR)
  Cell growth and death
   04218 Cellular senescence
    100547037 (MTOR)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    100547037 (MTOR)
   04920 Adipocytokine signaling pathway
    100547037 (MTOR)
Enzymes [BR:mgp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100547037 (MTOR)
Protein kinases [BR:mgp01001]
 Serine/threonine kinases: Other
  PIKK family [OT]
   100547037 (MTOR)
Membrane trafficking [BR:mgp04131]
 Autophagy
  Other autophagy associated proteins
   mTORC1 complex
    100547037 (MTOR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAT PI3_PI4_kinase DUF3385 FRB_dom FATC HEAT_2 IFRD HEAT_EZ UME EPSP_synthase CFIA_Pcf11
Motif
Other DBs
NCBI-GeneID: 100547037
NCBI-ProteinID: XP_010721303
Ensembl: ENSMGAG00000004758
Position
23
AA seq 2521 aa AA seqDB search
MSGTVSILQQFANGLKSRSEETRAKAAKDLQHYVTMELREMSQEESTRFYDQLNHHIFEL
VSSSDANERKGGILAIASLIGVEGGNATRIGRFANYLRNLLPSNDPVVMEMASKAIGRLA
MAGDTFTAEYVEFEVKRALEWLGADRNEGRRHAAVLVLRELAISVPTFFFQQVQPFFDNI
FVAVWDPKQAIREGAVSALRACLILTTQREPKEMQKPQWYRHTYEEAEKGFDETLAKEKG
MNRDDRIHGALLILNELVRISSMEGERLREEMEEITQQQLVHDKYCKDLMGFSTKPRHIT
PFTSFQSLQPSQSNALAGLLGYNAHQGIMGFATSPVPAKSTLVESRCCRDLMEEKFDQVC
QWVLKCRTSKNSLIQMTVLNLLPRLAAFRPSAFTADQYLPDTMNHVLSCVKKEKERTAAF
QALGLLSVAVRSEFQAYLPKVLEIIKAALPPKDFAHKRQKSVQVDATVFTCISMLARAMG
PSIQQDIKELLEPMLAVGLSPALTAVLYDLSRQIPQLKKDIQDGLLKMLSLVLMHKPLRH
PGMPKGLAHQLASPSLTNIPEASDVGSITLALRTLGSFEFEGHSLTQFVRHCADHFLNSE
HKEIRMEAARTCSRLLTPSIHLISGHAHVVSQTAVQVVADVLSKLLVVGITDPDPDIRFC
VLASLDERFDAHLAQAENLQALFVALNDQVFEIRELAICTVGRLSSMNPAFVMPFLRKML
IQILTELEHSGVGRIKEQSARMLGHLVSNAPRLIRPYMEPILKALIVKLKDPDPDPNPGV
INNVLATIGELAQVSGLEMRKWVDELFIIIMDMLQDSSLLAKRQVALWTLGQLVASTGYV
VEPYRKYPTLLEVLLNFLKTEQNQGTRREAIRVLGLLGALDPYKHKVNIGMIDQSRDASA
VSLSESKSSQDSSDYSTSEMLVNMGNLPLDEFYPAVSMVALMRIFRDQSLSQHHTMVVQA
ITFIFKSLGLKCVQFLPQVMPTFLNVIRVCDGAIREFLFQQLGMLVSFVRSHIRPYMDEI
VTLMRDFWVMNNSIQSTIILLIEQIVVALGGEFKLYLPQLIPHMLRVFMHDNSQSRIVSV
KLLNAIQLFGANLDDYLHLLLPPIVKLFDAPDAPVVARKAALETVDRLTESLDFTDYASR
IIHPIVRTLDQSPELRTTAMDTLSSLVFQLGKKYQIFIPMVNKVLVRHRINHQRYDVLIC
RIVKGYTLADEEEDPLIYQHRMLRSNQGETLASGPVETGPMKKLHVSTINLQKAWGAARR
VSKDDWLEWLRRLSLELLKDSSSPSLRSCWALAQAYNPMARDLFNAAFVSCWSELNEDQQ
DELIRSIELALTSQDIAEVTQTLLNLAEFMEHSDKGPLPLRDDNGIVLLGERAAKCRAYA
KALHYKELEFQKGPTPAILESLISINNKLQQPEAAAGVLEYAMKHFGELEIQATWYEKLH
EWEDALVAYDKKMDTNKDDPELMLGRMRCLEALGEWGQLHQQCCEKWTQVNDETQAKMAR
MAAAAAWGLGQWDSMEEYTCMIPRDTHDGAFYRAVLALHQDLFSLAQQCIDKARDLLDAE
LTAMAGESYSRAYGAMVSCQMLSELEEVIQYKLVPERREIIRQIWWERLQGCQRIVEDWQ
RILMVRSLVVNPHEDMRTWLKYASLCGKSGRLALAHKTLVLLLGVDPSRQLDHPLPTVHP
QVTYAYMKHMWKSARKIDAFQHMQHFVQTMQQQAQHAIATEDQQHKQELHKLMARCFLKL
GEWQLNLQGINESTIPKVLQYYSAATEHDRNWYKAWHAWAVMNFEAVLHYKHQNQARDEK
KKLRHASGASITSANTEGSNSESDAESTENSPIPSPVQKKVTEDLSKTLLMYTVPAVQGF
FRSISLSRGNNLQDTLRVLTLWFDYGHWPDVNEALVEGVKAIQIDTWLQVIPQLIARIDT
PRPLVGRLIHQLLTDIGRYHPQALIYPLTVASKSTTTARHNAANKILKNMCEHSNTLVQQ
AMMVSEELIRVAILWHEMWHEGLEEASRLYFGERNVKGMFEVLEPLHAMMERGPQTLKET
SFNQAYGRDLMEAQEWCRKYMKSGNVKDLTQAWDLYYHVFRRISKQLPQLTSLELQYVSP
KLLMCRDLELAVPGTYDPNQPIIRIQSIAPSLQVITSKQRPRKLTLMGSNGHEFVFLLKG
HEDLRQDERVMQLFGLVNTLLANDPTSLRKNLSIQRYAVIPLSTNSGLIGWVPHCDTLHA
LIRDYREKKKILLNIEHRIMLRMAPDYDHLTLMQKVEVFEHAVNNTAGDDLAKLLWLKSP
SSEVWFDRRTNYTRSLAVMSMVGYILGLGDRHPSNLMLDRLSGKILHIDFGDCFEVAMTR
EKFPEKIPFRLTRMLTNAMEVTGLDGNYRITCHTVMEVLREHKDSVMAVLEAFVYDPLLN
WRLMDTNTKGNKRSRTRTDSYSASQSVEMLDGMELGETAHKKTGTTVPESIHSFIGDGLV
KPEALNKKAIQIINRVRDKLTGRDFSHDETLDVPTQVELLIKQATSHENLCQCYIGWCPF
W
NT seq 7566 nt NT seq  +upstreamnt  +downstreamnt
atgtcaggcactgtgtctattctccaacaatttgccaatggcttgaagagtcgcagtgaa
gaaacaagggcgaaagctgccaaggacctgcagcattatgtcaccatggaactccgtgaa
atgagccaggaggaatccaccaggttttatgatcagctgaaccatcacatttttgaactg
gtctctagctctgatgcaaatgaaaggaagggtggcattttggctatagcaagccttatt
ggtgtagaaggaggtaacgccacccgtatcggcaggtttgcaaactatctgaggaacctt
ttgccatccaatgacccagttgtaatggaaatggcttccaaggctatcgggcgacttgca
atggctggtgacaccttcacagctgagtatgtggagtttgaggtgaaacgtgctctggaa
tggctgggggctgacaggaatgaaggtcgaagacatgcagctgttcttgttctgcgtgag
ctggcaatcagtgtgcctaccttcttcttccaacaagtgcagccgttctttgacaatatt
tttgtggctgtgtgggatcccaaacaggccattcgagagggagccgtttctgccttaaga
gcctgccttatcctcaccactcagcgggaaccaaaagaaatgcagaaacctcagtggtac
agacatacatatgaagaggctgagaagggttttgatgaaactttggccaaggagaaagga
atgaaccgtgatgaccgaatccatggtgccttattgatcctcaatgagctcgtgaggatc
agcagtatggagggagagcgccttagagaggagatggaggagatcactcagcagcagctt
gtgcatgacaagtactgcaaagacctgatgggctttagtaccaaacctcgccacatcact
cccttcactagcttccagtctcttcagccctctcagtcaaatgctttggctggtcttctg
ggttacaatgcccaccaaggaatcatgggttttgcaacttcacctgtgccagcaaagtct
accttggtagaaagtcgatgctgcagggatctaatggaggaaaagtttgatcaggtgtgc
cagtgggttcttaagtgcagaaccagcaaaaactctttgatccagatgacagttctcaat
ctgctcccacggctggcggctttccgtccttcagcattcacagctgatcagtatcttcca
gacaccatgaaccatgttctcagctgtgtgaagaaggagaaggagagaacagcagccttc
caggccttgggtttgctttctgtggctgtcagatctgagtttcaagcttacctgccaaaa
gtccttgaaataataaaagcagctcttccaccaaaggactttgctcacaagaggcagaag
tctgtgcaggttgatgctacagtcttcacctgcattagtatgttggcacgagccatggga
ccaagtatccagcaggacattaaagagcttctggaacctatgctggctgtgggtctgagc
cctgctctaacagctgtgctgtacgacttgagtcgtcagatcccccagctaaagaaggat
atccaggatgggctgctgaaaatgctttcccttgttttaatgcacaaacctctgcgacat
ccaggcatgccaaaaggtcttgcccatcagctggcctcccctagcctcaccaacatccca
gaggccagtgatgtgggtagcatcacacttgccctacgtacgctgggcagctttgagttt
gaagggcattctctgactcagtttgtccggcattgtgcagaccactttctgaacagtgag
cacaaggagatacggatggaagcagcccgcacttgctctcgcttgctcacgccttccatc
cacttgatcagtggccatgcccacgtggtcagtcagacagcagtgcaggttgtggctgat
gttctcagcaaactgcttgtggttggaataacagacccagaccctgatatacgtttctgt
gtattggcatctctggatgagcgatttgatgctcaccttgcccaggcagaaaacttgcaa
gctctttttgtggccctgaatgatcaagtatttgaaatccgagagctcgccatctgtact
gtgggtcgcctgagcagcatgaaccccgcctttgtcatgcctttcctgcgcaagatgtta
atccagattctaacagaactagaacacagtggtgttggtaggattaaagagcaaagtgcc
aggatgttgggtcatctggtttctaatgctccacgcctcattcgtccatatatggagcct
atcctgaaggcactgattgtgaaactgaaagatcctgatccagatccaaatccaggggtg
attaacaacgttttagctaccataggggaacttgcacaggtcagtgggctggagatgagg
aagtgggtggatgaactcttcattataattatggacatgctacaggactcttccctgctg
gctaaaagacaagtggctctttggacactgggtcagcttgtggctagcactggttatgtg
gtggaaccatacaggaagtacccaactttactggaggtgcttctgaacttcctgaagact
gagcagaaccagggcacccgtagagaggctattcgtgtgttggggctgctgggtgctttg
gacccctacaaacacaaggtgaacattggcatgattgatcagtcacgagatgcttctgct
gtcagcctctcagagtccaaatctagccaggattcttcggattacagtaccagtgagatg
ctggtgaacatgggaaacctccctctggatgaattctatccagctgtctctatggtggca
ctgatgagaattttccgagaccagtccttgtcccagcaccacacaatggtggttcaggcc
atcacctttattttcaaatctcttggactgaagtgtgtgcagttcctgccccaggtcatg
ccaacgttccttaatgtaataagggtctgtgatggtgccatccgagagttcctgttccag
cagctggggatgttggtgtcctttgtgagaagccacattcggccctatatggatgaaatt
gtcaccctcatgagagacttctgggtcatgaacaactccatacagagcacaattatccta
cttattgagcaaattgtggtggctctaggaggcgagttcaagctctatctgcctcagctc
attcctcacatgttacgggtcttcatgcatgacaatagtcagagtcgaatcgtctctgtc
aagctattgaatgcaatccagctctttggagctaacctggatgactaccttcatttatta
ctacctcccattgtaaagctgtttgatgccccagatgccccagtggtggctcgcaaggct
gctcttgaaacggtggaccgcttgacagagtctctggattttaccgattatgcttcacga
attattcatcctattgtgagaacactggatcagagcccagagctacgaacaactgcaatg
gacactctctcctctctggtattccagctgggaaagaagtaccagatctttatcccgatg
gtaaacaaagttctggtgcgacacagaattaaccatcaacgctacgatgttcttatctgc
agaatcgtaaagggctacactcttgctgatgaagaggaggatcccctgatttatcaacat
cggatgttgagaagcaaccagggagaaactttggccagtggtcctgtggaaacaggtcct
atgaagaaattacatgttagcaccatcaacctgcagaaggcctggggagcagcaagaaga
gtctccaaagatgactggttggaatggttaagaagactcagtctggagctgctgaaagat
tcctcctcaccatccttgcgctcatgctgggccctggctcaggcatataatcctatggct
cgtgatctcttcaatgctgcttttgtttcatgttggtctgaactgaacgaagaccagcag
gatgagttgatccgaagcattgaattggctctgacttctcaggacattgcagaggtcact
cagacactgctgaacttggcagaattcatggaacacagcgacaagggtccactgcctttg
agagatgataatggcattgtccttctgggggagagagcagcaaagtgccgagcatatgcc
aaggctcttcactacaaggagctggaatttcagaagggccccactccagccattctagag
tctcttatcagcattaacaataaactgcaacagccagaagcagctgctggggtgctggaa
tatgccatgaaacactttggggagctggaaattcaagctacctggtatgaaaaacttcat
gaatgggaagatgctctggtggcctatgacaagaagatggacacaaacaaagatgatcct
gagctgatgctaggacgaatgcgttgcttggaagcacttggagaatggggccaactccac
cagcaatgctgtgagaagtggacgcaggtcaatgatgaaactcaagctaagatggcaagg
atggctgctgctgctgcctggggtctaggtcagtgggacagcatggaagaatatacctgc
atgatcccaagggacacccacgatggtgccttctacagggctgtactggctcttcatcag
gaccttttctcactggctcagcagtgcattgacaaggccagagatctgctcgatgctgag
ctgactgccatggcaggcgagagctacagtcgagcctatggagctatggtatcctgccag
atgctgtcagagctggaagaagttatccagtataaacttgtaccagaacgtcgtgagatc
atccgccagatatggtgggaaagactgcagggctgtcaacggattgtggaagactggcaa
agaatattgatggttaggtctcttgttgtgaatcctcacgaggacatgagaacttggctt
aagtatgccagcttgtgtggcaagagtgggagactggctttggcccataagacacttgtc
ctgctcttgggagtagatccatcccgacagctggatcacccactgccaacagtacatccc
caagtgacttatgcatacatgaaacacatgtggaagagcgcccgtaagatcgatgcattc
cagcacatgcagcacttcgtacagacgatgcagcagcaggcacagcatgctattgccact
gaggaccagcagcacaagcaagaactccacaagcttatggcacggtgtttcctgaaactg
ggtgagtggcagctgaacctgcaaggcatcaatgagagtaccatccccaaagtcttacag
tactacagtgctgcaacagagcacgatcgcaactggtacaaggcctggcacgcctgggca
gtgatgaattttgaagcagtgcttcactacaaacatcagaaccaggccagagatgagaag
aagaaattgcgtcatgccagtggtgccagtatcaccagtgccaacactgagggcagcaac
agtgagagtgatgcagagagcacagagaacagtcccatcccatctccagtgcagaaaaaa
gtcactgaggatttatccaagaccctcttgatgtacacagtccctgctgtccaaggcttc
ttcagatccatatctctgtctcgtggaaacaacctgcaagacactctcagagtccttact
ctatggtttgattatggtcactggcctgatgtgaatgaagctttggttgaaggggtcaag
gcaatccaaatagatacttggttgcaggttatccctcagcttattgcaagaattgacacc
cctcgaccattagtaggacgtctcattcatcagctcctcacagatattggacggtaccac
ccccaggctttgatctatcctttgactgtggcatctaaatccacgaccactgctcgccac
aatgctgcaaataaaatcttgaaaaacatgtgtgagcacagtaacacactggtgcagcag
gcaatgatggtaagtgaagagctaatccgtgtggcgatcctgtggcatgagatgtggcat
gaagggttggaagaagcatctcgtctgtacttcggagaaagaaatgtgaagggaatgttt
gaggtgctggaaccacttcatgctatgatggagcgtgggcctcagactttaaaagagaca
tccttcaatcaggcctatggcagagatctaatggaagctcaagagtggtgcaggaagtat
atgaaatcaggaaatgtcaaggacctaacccaggcttgggatctctattaccacgttttc
aggcgtatctcaaagcagttgcctcagctcacttctttggaactacagtacgtgtcacca
aaactcttaatgtgccgggacctggagttggcagtgccaggaacatatgatcccaaccag
cccatcatccgcattcagtccattgcaccctcacttcaggtcatcacctccaagcagcgg
cccaggaaactaacattaatgggaagcaatgggcatgagtttgtgttccttctgaaaggt
catgaagaccttcgtcaagatgaaagagtgatgcagctttttgggttggtcaacactctg
ctagcaaacgacccaacttctcttcgtaaaaacctcagcattcagagatacgctgttatt
ccactgtccacaaattcaggcttgataggttgggtcccccactgtgacacactgcatgcc
ctcattcgagactacagagagaagaagaagatcctgctgaacatcgaacatcgcatcatg
ctgaggatggctccagattatgaccacctgactttaatgcagaaggtagaagtatttgaa
catgctgtcaataacacagctggtgatgaccttgccaaactgctgtggttgaaaagtcca
agctcagaggtatggtttgacagaagaacaaactacactcgttcactggctgtgatgtca
atggttgggtacattttgggtcttggggacagacacccttccaatctgatgttagacaga
ctgagtggaaaaatcctgcatatcgactttggggactgttttgaggttgcaatgacaaga
gagaagttccctgagaagatcccatttcggttaacaaggatgctgacaaacgctatggag
gtgacgggccttgatggcaattacagaatcacctgccacacagtgatggaagtcctgcgt
gagcataaggacagtgtcatggctgtgctggaagcctttgtgtatgatccattattgaac
tggaggctgatggacacaaatacaaagggcaataaacgctcacgaacaagaacagactcc
tactcagccagccagtcagtagaaatgttagatggtatggaactgggggagacagcccat
aagaaaactgggaccacagtgcctgaatccatccattccttcataggagatggcctcgtg
aagccagaagctctaaataagaaagcaattcaaattatcaacagagttcgagataaactc
actggtcgagacttctctcatgatgaaacacttgatgtacccacacaagtagaattgctc
attaagcaggctacttctcatgagaatctgtgccagtgctacattggatggtgtcctttc
tggtaa

DBGET integrated database retrieval system