KEGG   Meleagris gallopavo (turkey): 100547044Help
Entry
100547044         CDS       T01523                                 

Gene name
LYZ
Definition
lysozyme
Orthology
K13915  
lysozyme C [EC:3.2.1.17]
Organism
mgp  Meleagris gallopavo (turkey)
Brite
Enzymes [BR:mgp01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     100547044 (LYZ)
Exosome [BR:mgp04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100547044 (LYZ)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Structure
PDB: 

Jmol
Position
1
AA seq 147 aa AA seqDB search
MRSLLILVLCFLPLAALGKVYGRCELAAAMKRLGLDNYRGYSLGNWVCAAKFESNFNTHA
TNRNTDGSTDYGILQINSRWWCNDGRTPGSKNLCNIPCSALLSSDITASVNCAKKIASGG
NGMNAWVAWRNRCKGTDVHAWIRGCRL
NT seq 444 nt NT seq  +upstreamnt  +downstreamnt
atgaggtctttgctaatcttggtgctttgcttcctgcccctggctgctctggggaaagtc
tatggacgatgtgagctggcagcagctatgaagcgtctgggacttgataactatcgggga
tacagcctgggaaactgggtgtgtgccgcaaaattcgagagtaacttcaacacacatgct
acaaaccgtaacaccgatgggagtaccgactacggaatcctacagatcaacagccgctgg
tggtgcaatgatggcaggaccccaggctccaagaacctgtgcaatatcccatgttcagca
ctgttgagctcagacataacagcgagcgtgaactgcgcgaagaagatcgccagcggtgga
aacggcatgaacgcgtgggtcgcctggcgcaaccgctgcaagggcaccgacgtccacgcg
tggatcagaggctgccggctgtga

DBGET integrated database retrieval system