KEGG   Meleagris gallopavo (turkey): 100547045Help
Entry
100547045         CDS       T01523                                 

Definition
ras-related C3 botulinum toxin substrate 2-like
Orthology
K07860  
Ras-related C3 botulinum toxin substrate 2
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
MAPK signaling pathway
Wnt signaling pathway
VEGF signaling pathway
Focal adhesion
Adherens junction
Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:mgp00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    100547045
   04310 Wnt signaling pathway
    100547045
   04370 VEGF signaling pathway
    100547045
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    100547045
  Cellular commiunity
   04510 Focal adhesion
    100547045
   04520 Adherens junction
    100547045
GTP-binding proteins [BR:mgp04031]
 Small (Monomeric) G-proteins
  Rho Family
   Rac/Cdc42 [OT]
    100547045
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 192 aa AA seqDB search
MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDSKPVNLGLWDTAG
QEDYDRLRPLSYPQTDVFLICFSLVSPASYENVRAKWFPEVRHHCPSTPIILVGTKLDLR
DDKDTIEKLKEKKLSPITYPQGLALAKEIDSVKYLECSALTQRGLKTVFDEAIRAVLCPQ
PTRTKKRACSLL
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atgcaagccatcaagtgtgtcgtggtgggagatggagctgtggggaaaacctgtctcctt
atcagctacaccaccaatgcctttccaggagaatacatccccactgtgtttgataactat
tctgccaatgtgatggttgacagcaagcctgtaaatctggggctatgggatactgctgga
caagaggattacgacaggctgaggccactctcttacccacagacggatgtcttcctgatc
tgcttctcccttgtcagcccagcatcttatgaaaacgtccgtgctaagtggttccctgag
gtgcgacaccattgccccagcactcccatcatcctggtgggcacaaagctggatcttcgt
gatgacaaagacaccattgagaagctgaaggagaagaagctttctcctattacatatcct
cagggtcttgccttggccaaggaaatcgactctgtgaaatacctcgaatgctcagcattg
acgcagcgtggcctgaagacggtgtttgatgaggccatccgagcagtcctctgcccacag
cccacccgaacaaagaaacgagcatgcagcctcctctag

DBGET integrated database retrieval system