KEGG   Meleagris gallopavo (turkey): 100547079Help
Entry
100547079         CDS       T01523                                 

Gene name
EEF2K
Definition
eukaryotic elongation factor-2 kinase
Orthology
K08292  
elongation factor 2 kinase [EC:2.7.11.20]
Organism
mgp  Meleagris gallopavo (turkey)
Brite
Enzymes [BR:mgp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.20  elongation factor 2 kinase
     100547079 (EEF2K)
Protein kinases [BR:mgp01001]
 Serine/threonine protein kinases: Atypical group
  Alpha family [Table]
   100547079 (EEF2K)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
16
AA seq 702 aa AA seqDB search
MADEDLIFRMEGIDNARLTELTSGNYLDADSDDEDNYYICPITDDPVSNKSASSKVDNYY
SNLAKTEQYSSSSSPRNSFNYKETWKHAIEKAKHMPDPWAEFHLEDIETEHATRYRYNAV
TGDWVEDEVLIKMASQPFGRGAMRECFRTKKLSNFLHTQNWKAAYNYVAKRYIESVGREV
YFEDVRLQMEAKLWGEEYNRHKPPKQVDIVQTCIIEMKNRPGKPLFHLEHYIEGKYIKYN
SNSGFVRDDNIRLTPQAFSHFTFERSGHQLIIVDIQGVGDLYTDPQIHTESGTDFGDGNL
GVRGMALFFHSHSCNKICKSMGLAPFDLSSKEKDALDHSNKLLESAQTILRGTEEKCGSS
RVRTISGSRPPLLSRLSENSGDESMSDVAFDSLPCSPSSATPHSQKMDVLHWPVFNEVDN
LVHKDSDQLDNQRDFENGGDSGYPSEKRSELEDLDHREKGHSNNNRRHESDEDSLGSSAR
ISVEKWNLYNSSRVHIHRPSCVAQEIQRLNALELEKKIGKSILGKVHLAMVRYHEAGRFC
EKDKDWDRESALFHLEHAADCGELEAIVGLGLMCSQLPHHILSEVTLEDTKENRKKGFDY
LLRAAEAGDRPSMILVARAYDTGVNLGSDRAQDWKEALYWYNHSEDRYPYIVMIVSDVKL
KILGGGRDLYTEAAEAAMEAMKGRLANQYYQKAEEAWAMMEE
NT seq 2109 nt NT seq  +upstreamnt  +downstreamnt
atggccgacgaggaccttatcttccgtatggaagggattgataatgctagattgactgaa
ctgacctctggaaattatctggatgcagacagtgatgatgaagacaactattatatctgc
ccaataactgatgatccagtttctaacaagtctgccagtagtaaagttgacaattattac
agcaacttagccaaaaccgagcagtacagttccagctcttctcctagaaactcctttaac
tacaaggaaacctggaaacatgctattgagaaagctaagcacatgcctgatccctgggca
gaatttcatcttgaggacatcgagaccgaacacgccactcgctacaggtacaatgcagtt
actggggactgggttgaagatgaagttctcatcaagatggcttcacaaccctttggccgt
ggagcaatgcgagaatgtttcagaacgaaaaagctatccaacttcttacacactcagaac
tggaaagctgcctataactacgttgccaagcggtacatagagagcgtaggcagggaggtg
tactttgaggatgtccgacttcagatggaagcaaagctctggggagaagagtacaaccgg
cacaaaccacccaagcaggtggatatagtacagacctgtattatcgaaatgaagaacaga
cccggaaagcctctctttcatctggaacattacattgagggcaaatacatcaaatacaac
tcaaattctggatttgtgcgagatgacaacattcggcttactccgcaagccttcagtcac
ttcacatttgagcgctcaggacatcaactcattattgtcgatatccagggagttggagat
ctttacacagaccctcaaatccatacagagagtggtacagattttggagatggcaaccta
ggtgttcgaggtatggccttattctttcattctcattcctgtaacaagatttgcaaaagc
atgggccttgcaccatttgacctttcatccaaagaaaaagatgccttggatcatagtaac
aaattgcttgaatcagctcagacaattctgcgtggcacagaggagaaatgtggcagcagc
agggtgagaaccatctctggtagtcggcctcccctgctctcccgcctgtctgagaactct
ggagatgaaagcatgagtgatgtggcatttgactctctgccctgctctccttcttctgca
accccccacagccaaaagatggacgtgcttcattggcccgtgttcaatgaagtagataat
ttggttcacaaagactctgatcagcttgataaccaaagggattttgaaaatggtggagac
agtggatatcccagtgagaagagaagtgagctagaagatctggatcatagagagaagggc
cattcaaacaacaaccgaagacatgaatctgatgaagacagtttgggaagctctgcaagg
ataagtgtggagaaatggaatctctacaattcttccagagtccacatccacagaccatcc
tgcgttgctcaagaaattcagaggctcaatgcactagaacttgaaaagaaaattgggaag
tcaatccttgggaaggttcatctggccatggttcgttaccatgaagctgggcgtttctgt
gagaaggacaaagattgggatcgtgagtcggctctgttccacctggagcacgctgcagac
tgcggggagctggaagccattgtggggttaggactcatgtgctctcagctgccacatcac
attctttctgaggtcactttagaggacacaaaggagaacagaaaaaagggatttgattac
ttgctgagagcagcagaagctggagaccggccttccatgattctggtagcaagagcatac
gatacaggtgtcaatctaggttcagacagagcacaggattggaaggaagctctgtactgg
tacaaccattcagaggatcggtacccttacattgtaatgatagtgagtgatgtaaagctg
aaaatcctggggggagggcgtgatctctacacagaagcagcagaagcagcaatggaagca
atgaagggcagactggcaaatcagtactaccagaaagcagaagaggcttgggcgatgatg
gaagaatga

DBGET integrated database retrieval system