KEGG   Meleagris gallopavo (turkey): 100547219Help
Entry
100547219         CDS       T01523                                 

Definition
protein disulfide-isomerase A5-like
Orthology
K09583  
protein disulfide isomerase family A, member 5 [EC:5.3.4.1]
Organism
mgp  Meleagris gallopavo (turkey)
Brite
Enzymes [BR:mgp01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     100547219
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
7
AA seq 272 aa AA seqDB search
MNPGSCLFSVTSLAGCSSVGPVEFTCPQEVAYRVLAGMNVYSAEFERIKEEYNVRGYPTI
CYFEKGKFLFHFENYGATAADIAEWLKNPQAPQPQAPEIPWADEENVVYHLTDEDFDKFI
KDHSSVLVMFHAPWCGHCKKMKPEYEKAAEFLHAGSDSPGVLAAVDATVNKALAERYHIS
GFPTVKYFKDGEEKYTLPHLRTKKKIIDWLQNPEAPPPPEPAWEEKQSSVIHLAGEDFRE
SLKKKKHTLVMFYAPCEYTLLYVIEFYKPYSL
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgaatccaggttcttgtctcttctcagtcaccagtctggctggatgcagttcagttggt
cctgttgaatttacctgtcctcaagaggtggcatatagggttcttgcaggaatgaacgtt
tactctgctgaatttgaaaggataaaggaagaatacaatgtccgtggatatcctacaatc
tgctattttgagaaaggaaagttcctgttccattttgagaactatggtgctactgcggca
gatatagcagagtggctgaaaaacccgcaggcacctcagccacaggctccggagattccc
tgggcagatgaggaaaatgtagtttatcacctgaccgatgaggacttcgacaagttcata
aaagatcattcatctgtcctagtgatgttccatgcaccatggtgtgggcactgtaagaaa
atgaagccagaatatgagaaggctgcagagtttctccatgcaggcagtgatagcccaggt
gtccttgcagcagtagatgctaccgtcaacaaagcactggcagaaagataccacatctca
gggtttcctactgtgaagtactttaaggatggagaagagaaatacactctgccacacctc
agaacgaaaaagaagatcattgattggctgcaaaatcctgaggcaccacctccacctgag
cctgcatgggaagaaaaacagagcagtgttatccatcttgctggagaagacttcagggag
tccttgaagaagaagaagcacacccttgtcatgttctacgcaccgtgtgagtacacactt
ctgtatgtgattgagttttataagccctacagcttatga

DBGET integrated database retrieval system