KEGG   Meleagris gallopavo (turkey): 100547219Help
Entry
100547219         CDS       T01523                                 

Definition
protein disulfide-isomerase A5-like
Orthology
K09583  
protein disulfide isomerase family A, member 5 [EC:5.3.4.1]
Organism
mgp  Meleagris gallopavo (turkey)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
7
AA seq 524 aa AA seqDB search
MQTLVGRRELLGAADNLLAFLLAFGYSLKLSPLIEKISDHKDFKKLLRTRNNVLVLYSKS
AAAAESSLRLLSNVAQEVKGRGTISWIDCGDTESRKLCKKMKVDPNSKEKGVELLHYKDG
AFHTEYNRAVTLKSIVAFLKDPEGAPLWEEDPEAKDIVHVDSEKELRRLLKKEDRPLLMM
FYAPWCGVCKRMMPSFQQAATELKGKYVLAGMNVYSAEFERIKEEYNVRGYPTICYFEKG
KFLFHFENYGATAADIAEWLKNPQAPQPQAPEIPWADEENVVYHLTDEDFDKFIKDHSSV
LVMFHAPWCGHCKKMKPEYEKAAEFLHAGSDSPGVLAAVDATVNKALAERYHISGFPTVK
YFKDGEEKYTLPHLRTKKKIIDWLQNPEAPPPPEPAWEEKQSSVIHLAGEDFRESLKKKK
HTLVMFYAPWCPHCKNAIPHFTTAAEVFKEDRKMAYAAVDCAKDQNHDLCKQEGVDGYPT
FNYYNYGKFVEKYTGERGEAGFTTFMRALRERDHERVGKKKDEL
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
atgcaaacgctggttggaaggcgtgaactcctcggtgcagccgataacctcctggcattc
ctgctggcgtttgggtactcattgaaattgtctcctctcatagaaaaaataagtgaccac
aaggattttaagaagcttctcaggacacgaaacaacgtactagtgctgtattccaaatct
gctgctgctgcagaaagctcactcaggttactgtctaatgtggcccaggaggtgaaagga
cgaggtactataagctggatagactgtggtgacactgagagccgaaaattatgcaagaag
atgaaagtagatcctaattcaaaggagaaaggagtggaattactccattataaggatggt
gcatttcatactgaatataacagagctgtcaccttgaagtctattgtggcctttctcaaa
gatccagaaggcgctccattgtgggaggaagatcctgaagccaaagacattgtgcatgtt
gacagtgaaaaggaattacgaaggcttctgaagaaggaagacagaccccttctgatgatg
ttctatgccccatggtgtggtgtttgtaagagaatgatgccgtcttttcagcaggcagcc
acagaactgaagggtaaatatgttcttgcaggaatgaacgtttactctgctgaatttgaa
aggataaaggaagaatacaatgtccgtggatatcctacaatctgctattttgagaaagga
aagttcctgttccattttgagaactatggtgctactgcggcagatatagcagagtggctg
aaaaacccgcaggcacctcagccacaggctccggagattccctgggcagatgaggaaaat
gtagtttatcacctgaccgatgaggacttcgacaagttcataaaagatcattcatctgtc
ctagtgatgttccatgcaccatggtgtgggcactgtaagaaaatgaagccagaatatgag
aaggctgcagagtttctccatgcaggcagtgatagcccaggtgtccttgcagcagtagat
gctaccgtcaacaaagcactggcagaaagataccacatctcagggtttcctactgtgaag
tactttaaggatggagaagagaaatacactctgccacacctcagaacgaaaaagaagatc
attgattggctgcaaaatcctgaggcaccacctccacctgagcctgcatgggaagaaaaa
cagagcagtgttatccatcttgctggagaagacttcagggagtccttgaagaagaagaag
cacacccttgtcatgttctacgcaccgtggtgccctcactgtaaaaatgccattccacat
tttacaactgctgccgaagtctttaaagaagatcgaaagatggcctacgctgcggtggac
tgtgccaaagatcagaatcatgacctgtgcaagcaggagggagttgatggctaccccacc
ttcaactattacaactacgggaaatttgtggaaaaatatactggagagagaggggaggct
ggattcaccactttcatgcgagcccttagagaaagagaccatgagagagtaggaaagaag
aaggatgaattgtaa

DBGET integrated database retrieval system