KEGG   Meleagris gallopavo (turkey): 100547268Help
Entry
100547268         CDS       T01523                                 

Gene name
GUK1
Definition
(RefSeq) guanylate kinase 1
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
mgp00230  Purine metabolism
mgp01100  Metabolic pathways
Module
mgp_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:mgp00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    100547268 (GUK1)
Enzymes [BR:mgp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     100547268 (GUK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Guanylate_kin AAA_16 MMR_HSR1 AAA_33 ABC_tran AAA_18 RsgA_GTPase AAA_22 NTPase_1 AAA_14 AAA AAA_29 RNA_helicase KAP_NTPase AAA_28 AAA_23 ATPase_2 AAA_24 AAA_30 NACHT cobW Gtr1_RagA AAA_17 NB-ARC Viral_helicase1 Zeta_toxin AAA_5 TsaE
Motif
Other DBs
NCBI-GeneID: 100547268
NCBI-ProteinID: XP_003206930
Ensembl: ENSMGAG00000002569
UniProt: G1MUI4
Position
6
AA seq 198 aa AA seqDB search
MQGPRPVVLSGPSGAGKSTLIKKLFKDYENIFGFSVSHTTRQPRPGEVNGKDYHFVTREE
MKKEIDAGEFIEHAEFSGNMYGTSKRAVQAVQAKNQICILDIDIQGVKNIKKTDLNPIYI
SVQPPSIDVLEKRLRDRQTETEESLQKRLTAARVDLELSKEPGLFDLVIINDDLEKAYSE
LKEQLLKEIQKAQESRKS
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgcagggaccgagaccagtggttctgagtggcccatcaggtgcagggaagagcactttg
ataaagaaattgtttaaggattatgagaacatctttggcttcagcgtctctcatacaacg
aggcagccgagacctggagaagtaaatggcaaagattaccactttgtgaccagagaggaa
atgaagaaagaaatcgatgctggtgaattcattgagcacgcagagttctcaggaaatatg
tatgggacgagtaaacgtgcagtgcaggctgttcaagccaagaaccagatctgcatcctg
gacattgacatccaaggcgtaaagaacatcaagaagacagacctgaaccccatctacatc
tctgtgcagcctccgtccatagacgtcctggaaaaaaggctgcgtgaccgacagactgag
acagaagaaagtctacagaagcgtttgactgcagcccgtgtagatctggaacttagtaaa
gagcctggcctctttgacttggtcattattaatgatgatctagaaaaagcctattcagaa
ctgaaggagcagctcctgaaggaaatccagaaggcccaagaatccaggaagtcctga

DBGET integrated database retrieval system