KEGG   Meleagris gallopavo (turkey): 100547268Help
Entry
100547268         CDS       T01523                                 

Definition
guanylate kinase-like
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:mgp00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    100547268
Enzymes [BR:mgp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     100547268
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
6
AA seq 198 aa AA seqDB search
MQGPRPVVLSGPSGAGKSTLIKKLFKDYENIFGFSVSHTTRQPRPGEVNGKDYHFVTREE
MKKEIDAGEFIEHAEFSGNMYGTSKRAVQAVQAKNQICILDIDIQGVKNIKKTDLNPIYI
SVQPPSIDVLEKRLRDRQTETEESLQKRLTAARVDLELSKEPGLFDLVIINDDLEKAYSE
LKEQLLKEIQKAQESRKS
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgcagggaccgagaccagtggttctgagtggcccatcaggtgcagggaagagcactttg
ataaagaaattgtttaaggattatgagaacatctttggcttcagcgtctctcatacaacg
aggcagccgagacctggagaagtaaatggcaaagattaccactttgtgaccagagaggaa
atgaagaaagaaatcgatgctggtgaattcattgagcacgcagagttctcaggaaatatg
tatgggacgagtaaacgtgcagtgcaggctgttcaagccaagaaccagatctgcatcctg
gacattgacatccaaggcgtaaagaacatcaagaagacagacctgaaccccatctacatc
tctgtgcagcctccgtccatagacgtcctggaaaaaaggctgcgtgaccgacagactgag
acagaagaaagtctacagaagcgtttgactgcagcccgtgtagatctggaacttagtaaa
gagcctggcctctttgacttggtcattattaatgatgatctagaaaaagcctattcagaa
ctgaaggagcagctcctgaaggaaatccagaaggcccaagaatccaggaagtcctga

DBGET integrated database retrieval system