KEGG   Meleagris gallopavo (turkey): 100547270Help
Entry
100547270         CDS       T01523                                 

Gene name
USP40
Definition
ubiquitin specific peptidase 40
Orthology
K11869  
ubiquitin carboxyl-terminal hydrolase 40 [EC:3.4.19.12]
Organism
mgp  Meleagris gallopavo (turkey)
Brite
Enzymes [BR:mgp01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100547270 (USP40)
Peptidases [BR:mgp01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100547270 (USP40)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
7
AA seq 1244 aa AA seqDB search
MFGDLFEEDFSFISNNHYGKGKKSRPKDSEPPAPRDFTNLSGIKNQGGTCYLNSLLQTLL
FTPEFREALFSLGPEELGTLDDVGKPDAKVRIIPLQLQRLFAQLLLLDQQAASTTDLTES
FGWNSNEEMRQHDVQELNRILFSALESSLVGTSGHDLINRLYHGTVVNQIVCKECKNISE
RQEDFLDLTVAVKGVTGLEEALWNMYVEEEYFENENLYRCGACDKLVEASKSAKLHKLPP
FLTISLLRFNFDFEKCERYKETSCYTFPFQINLRPFCEQTEMDDSEYMYELFSVIIHKGG
CYGGHYHVYIRDVDELGNWQLQEDEDRLIEDKPSRENENAKETENPLAVLKGILSEEECK
QIPVDQLGQKFLEKIKMSWNKKYRKQYGALRKYLQNHPQIFQFSPDENKVGLKEKYKLQF
KSDFQGQDFWSPPQENGIQWNSEKEPLRLGESSAGCHWFDLNDSKVQPIKEEDIEKQFQG
KESAYMLFYRKSQLKRPPEARGNPRYQIPEHLLNEMNAANMELQKKRAECDSANNSIDLR
LHLSTCYKFHNGALHPSLSWRESVLDLTVDRRKTLGDLRQSIFQMMKSWEGDMVLSSAKP
LPAGLHLYQILDGDELTLDCFGLVDGADVFVWNGKEVGGVKVMAGPDHEPVLLNILRLVE
HNEGGKGQHFTESQHIFPCSTKLSDLCKALAPAGGIILKNDSGYKEAKNWEVFLEEHMKE
TIKTIGLTDGCSVLILDSHDQSLVNISSGNLSAFTYDISWLQVKNFCGTDDEEKHVKITA
TIETVMSDIKMKAIHELQLEEELASESCLRPVSRNGKLLSPVPEDYTVKEAELKMGSLLG
LCRGKAPTSTQLFLYFIIERDHFTSPEMEIVVEETASVKECLNLMLEKSGLSGDSWHLRR
MDWCFEAGEALSQENATLKELNVCRGDTLVVTEGKLPPKGFLKIPIWWLKSSSQTKHEEK
ARDQVNGMTCKMDALQVSPAGDSPEYIQADMDLCYAGITEIAGESSLEDLKMQALTLPQC
PEHVIPLPTFLRAWTVENRRPGRLLRHNKQQLSEYKLGARVEICIEPLQKEENLSPHELL
LRVQMGIPGKRDYYNPMDLVWNISKECTTWALRQRVASHYCLPVDKIEIAKYFPEKFEWL
PISSWTQQISKRKRKKKQESLQSAPYHLKDGDIIGVKNLLLDDSKDFSTVRDDVGKQKQR
QLALEKKKSQQAERSQDHVLSEEKLNIKHRKPEVALSINVGVFR
NT seq 3735 nt NT seq  +upstreamnt  +downstreamnt
atgtttggggacttatttgaagaggatttttcctttatttcaaacaatcattatggaaaa
ggaaagaaatcaaggcccaaagattctgagcctccagctcccagagattttaccaatctt
agtggtatcaaaaaccaaggtgggacctgctacctcaattcccttctgcagactctgctt
ttcacaccagaattcagagaggcactgttctctctaggacctgaagaacttgggactctg
gatgatgttggcaaaccagatgcaaaagttcggataattccattacaacttcaacggtta
tttgcccagctcctgctcttagatcagcaggctgcatctacaacagaccttactgagagc
tttggttggaacagcaatgaggaaatgaggcagcatgatgtgcaggagctgaatcggatt
ctgttcagtgctttggagagttcccttgtgggaacttcgggtcatgaccttattaatcga
ttgtaccacgggactgttgtcaaccagattgtttgtaaagaatgcaagaacatcagtgag
agacaggaagattttttagacctaacagtggcagtaaaaggtgtaactggtttggaggag
gccctgtggaacatgtatgtggaagaggaatactttgaaaatgagaacttgtatcgatgt
ggagcctgtgataagcttgttgaggcatcaaagtcagctaaactacataagttgcctccc
tttctcaccatctctctcctgagatttaactttgactttgagaagtgtgaacgatacaag
gaaactagttgctataccttccctttccagataaatctgaggcctttttgtgagcagact
gaaatggatgattcagagtacatgtatgagctcttctctgttattatacataaaggtggc
tgctatggaggacactatcatgtttatatcagagatgtggatgaattaggaaactggcaa
ttacaagaagatgaggataggctgattgaagataaaccttcaagagagaatgaaaatgcc
aaagaaacagaaaatccattggcagtattgaaagggattttatcagaggaagaatgtaaa
caaattcctgtggatcaattagggcagaaattcttggagaaaataaagatgtcctggaac
aagaaataccgaaaacagtacggagcattacgaaagtatttgcagaatcatccccagata
tttcagttcagtcctgatgaaaataaagttggtttaaaggaaaaatacaagctccaattt
aagtctgattttcaaggacaagatttctggagccctcctcaggagaatggtatccaatgg
aattcagaaaaagaacctctaaggctaggagagagttctgctggttgccattggtttgat
ctgaatgattcaaaagtccagcccatcaaagaggaggatattgagaaacaatttcagggt
aaagagagtgcctacatgctgttctatcgcaagtctcagttgaaaagacctcctgaagct
cgaggaaatccaaggtaccaaattcctgaacatcttctgaatgaaatgaatgctgctaac
atggagctgcaaaaaaagagagcggagtgtgactcggcaaacaatagcattgatttacgt
ctccatttgagcacatgttataaatttcacaatggggccttgcatccttcacttagttgg
agagagagcgttctagatctgactgttgacagaagaaaaactctaggagaccttcgacaa
tcaattttccagatgatgaaatcttgggaaggagacatggttctcagtagtgctaaacct
ttaccagcagggctgcacctttaccagatacttgatggagatgagctgacactggactgc
tttgggctggttgatggagcagacgtttttgtgtggaatgggaaggaggttggtggcgtg
aaggtgatggcaggccctgatcatgaacctgttctcttaaacattcttcgtttagtggaa
cataatgaaggagggaagggtcagcatttcacagaatcgcagcacatttttccatgcagc
acaaaactcagtgatctgtgcaaagcattagcaccagcaggaggaataatcttaaagaat
gactcaggatataaagaagccaagaactgggaggtttttcttgaagaacatatgaaggaa
accatcaaaaccattggtctgacagatggatgttcagtattaatcttagacagccatgat
caaagcttggtgaatatttcaagtggtaatttgtctgcttttacatacgacatcagctgg
ctccaggtgaaaaacttctgtggaacggatgatgaagagaaacatgttaaaattactgcc
acaattgaaacagtgatgtcagatatcaagatgaaagcaatacacgagctacagctagag
gaggagctagcaagtgaaagctgtcttagacctgttagcagaaatgggaaacttctctct
ccagtgcctgaggattatactgtcaaggaggcagaactgaaaatgggaagcttgctaggg
ttgtgtcgtggaaaagctccaacttccactcagctctttttatattttattattgaacgt
gaccactttacaagccctgagatggaaattgttgtggaagagactgcctctgtgaaagaa
tgtctaaatttaatgctggaaaaatctggattatcaggtgacagctggcatttgagaagg
atggactggtgctttgaagcaggagaagctttaagtcaagaaaatgctactttgaaggaa
cttaatgtttgcagaggagatactttggttgtaactgaaggaaagcttccaccgaagggt
ttcttgaaaatacctatttggtggttgaagtcttcgagtcaaacaaaacatgaagagaag
gcacgagaccaggtgaatgggatgacctgcaagatggatgctttgcaagtgtctcctgca
ggagattcaccagaatacatccaagcagacatggatctgtgctatgctggcattacagaa
atagcaggcgaatcttctttggaagatctgaagatgcaggctctgaccttaccacagtgc
ccagagcacgttatcccactgcccacgtttctcagagcctggacagtggaaaacaggcgc
ccaggcaggctgctacgacacaacaagcagcaactcagtgaatataagctgggtgccaga
gtggaaatctgcatagaacctttgcagaaagaagagaacttgagcccgcatgaattgctg
cttcgagtacagatgggcataccggggaaaagggactactataaccccatggatttggtg
tggaatatctccaaagaatgcactacctgggcactgaggcaaagagtggcttctcactat
tgtctccctgtagataaaattgaaatagccaaatacttccctgaaaaatttgagtggctg
ccaatatctagctggacccagcaaatttcgaagagaaaacggaagaaaaaacaggagagt
ttacagtcagctccttatcacctaaaagatggagatatcattggggtgaagaatcttctc
cttgatgacagtaaggatttcagcacagtgagagatgatgttggaaaacagaagcaaagg
cagcttgcattagagaaaaagaaaagtcagcaagctgaacgctcccaggaccatgttcta
tctgaggaaaaactgaatattaagcatcgtaaaccagaagtggctctttccatcaacgtg
ggagttttcagatag

DBGET integrated database retrieval system