KEGG   Meleagris gallopavo (turkey): 100547308Help
Entry
100547308         CDS       T01523                                 

Gene name
GYS2
Definition
(RefSeq) glycogen synthase 2 (liver)
  KO
K00693  
glycogen(starch) synthase [EC:2.4.1.11]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
Starch and sucrose metabolism
Insulin signaling pathway
Brite
KEGG Orthology (KO) [BR:mgp00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    100547308 (GYS2)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    100547308 (GYS2)
Enzymes [BR:mgp01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     100547308 (GYS2)
Glycosyltransferases [BR:mgp01003]
 Polysaccharide
  Storage polysaccharide
   100547308 (GYS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
1
AA seq 704 aa AA seqDB search
MPLARSLSMTSLNGLPQWEDEDLPVEDLLLFEVSWEVTNKVGGIYTVIQTKAKITADEWG
ENYFLIGPYFEHNVKTQVEVCEPPNPAIKKAMDTMKSQGCQVFFGRWLIEGSPYVLLFDI
GSAAWNLDRWKGEFWDATNIGIPFHDREANDAVIFGSVTAWFLKELSCQFDDKPNIVAHF
HEWQAGVGLILSRSQKLPVATIFTTHATLLGRYLCAANIDFYNNLDQFDIDKEAGERQIY
HRYCMERASVHCAHVFTTVSQITAIEAEHMLKRNPDVVTPNGLNIKKFSAMHEFQNLHSM
YKARIQEFIRGHFYGHLDFSLENTLFFFIAGRYEFSNKGADMFLEALSRLNFLLRVHKSD
VTVVVFFIMPAKTNNFNVETLKGQAVRKQLWDTAQSVKEKFGKKLYNALLKGEIPDLSKI
LDRDDITIMKRAIFSTQRHCLPPVTTHNMIDDGNDPILNTIRRIGLFNNRTDRVKVIVHP
EFLSSTSPLLPLDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSVTTNLSGFGCFMQ
EHVADPAAYGIYIVDRRFRSPDESCNQLTQFLYGFCQQSRRQRIIQRNRTERLSDLLDWR
YLGRYYMHARHLALSRTFPDKFEMEPCAPPKTEGFRFPRPSSVPPSPSVSQHSSPHHSEA
EDEDEDERYDEDEEAERDRQNIKSPFSLGVLPQGKKKQHGEFRN
NT seq 2115 nt NT seq  +upstreamnt  +downstreamnt
atgccactggctagatcactgtccatgacctctcttaatgggcttcctcaatgggaagat
gaagacctaccagtggaggatttgttgctctttgaagtttcttgggaagttaccaacaaa
gtgggaggaatttataccgtgatccagacgaaagccaaaattacagcagacgaatggggt
gaaaactattttctgattggtccttattttgagcacaatgtgaagactcaggtggaagta
tgtgagcctccaaaccctgcaattaagaaggcaatggataccatgaaaagccaagggtgt
caggtcttttttggaagatggctgatagagggcagtccatatgtcttactgtttgatata
ggatcagcagcctggaatctggacagatggaaaggcgaattttgggatgctaccaacata
gggattccttttcatgaccgagaagccaatgatgctgtaatttttggatcagtaacagcc
tggtttttaaaagagctttcctgtcagtttgatgacaagcccaacatagttgctcatttc
catgaatggcaggcaggagtgggtttaatactgtctcgatctcagaaacttccagttgcc
acaatttttactacccatgccactctgcttgggagatacttgtgtgcagccaatatagac
ttttacaacaatcttgaccagtttgacattgacaaggaagcaggagagagacagatttac
catcgatattgtatggaacgggcatccgtacactgtgcccatgtgttcaccacagtctca
cagataacagcaattgaagcagagcacatgcttaaaagaaatcctgatgttgtcactcca
aatggcttgaacattaagaagttttcagcaatgcatgaatttcagaatttgcattccatg
tacaaggctaggattcaagagttcattcgaggtcatttctatggccaccttgacttcagt
cttgaaaataccttatttttcttcattgctgggagatatgaattttccaacaaaggagct
gatatgtttctagaagccttatcaagactaaactttttgctgagggtacataagagtgat
gttacagttgttgtgttcttcattatgccagcaaagacaaacaatttcaatgtggaaacc
ctgaaaggacaagcagtccggaagcagctctgggacactgcacaatctgtgaaagaaaag
tttggaaagaaactctacaatgccttactaaaaggagaaattccagacttgagcaagatt
cttgaccgggatgatataaccattatgaaaagagctatcttttcaactcagcgacactgt
ctgcctccggtgaccacccacaacatgattgacgatggcaatgatccaatactcaatacc
atccgacgtattggccttttcaacaaccgaacagacagagtaaaggtgatagtacatcca
gagtttctttcttcgacaagcccgttgctgcccttggactatgaagaatttgttagaggt
tgtcacttgggtgtatttccatcatactatgaaccctggggttatactccagctgaatgt
actgtgatgggtattcccagtgtgaccacaaacctttctggattcggctgtttcatgcag
gaacatgttgctgacccagctgcttatggtatctacatagttgacaggaggttccgctca
cctgatgaatcatgcaaccagctgactcagttcctgtatggattttgtcagcagtcccgt
cgccagaggatcatccaaagaaaccgaactgagaggctctcagatctgttggactggaga
tacctaggcaggtattacatgcatgctagacacttggccctcagcagaacattccctgat
aaatttgagatggaaccatgtgctccaccaaagacggaaggtttcagattcccaagacct
tcatcagtgccaccatcaccttctgtctctcaacattccagccctcaccatagtgaagcc
gaagacgaagatgaggatgaaagatatgatgaggatgaggaagctgaaagggataggcaa
aatattaagtctccattttcacttggagtattgccacaaggaaagaagaagcagcatgga
gagttcaggaactga

DBGET integrated database retrieval system