KEGG   Meleagris gallopavo (turkey): 100547334Help
Entry
100547334         CDS       T01523                                 

Definition
(RefSeq) protein unc-13 homolog C-like
  KO
K15293  
protein unc-13 A/B/C
Organism
mgp  Meleagris gallopavo (turkey)
Brite
Membrane trafficking [BR:mgp04131]
 SNARE
  SNARE associated proteins
   Syntaxin-binding proteins
    100547334
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Ensembl: 
Position
12
AA seq 580 aa AA seqDB search
MPVHFSCLSSKYMCPGVPAVMSTLLANINAFYAHTTATTNVSASDRFAATNFGREKFIKL
LDQLHNSLRIDLSKYRDNFPASNSERLQDLKSTVDLLTSITFFRMKVLELQSPPRASTVV
KDCVRACLDSTYKYIFDNCYDLYSQLIDQGKKQEVPKEEQGPTTKNLDFWAQLITLMVTI
IDEDKTAYTPVLNQFPQELNMGKISAEIMWTLFAQDMKYALEEHENQRLCKSTDYMNLHF
KVKWFYNEYVRELHAFKDAVPEYSLWFEPFVIQWLDENEDVSMEFLHGALERDKKDGFQQ
TSDHALFSCSVVDVFTQLNQSFEIIRKLECPNPEALSHLMRRFAKTINKVLLQYAAIISS
YFSSYCDKENVPCILMNNIQQLRVQLEKMFESMGGKELDQEASAVLKELQAKLSNVLDEL
SVTYATSFQSIIEDCIRQMSSELNQMRGNGTAAANKNSAAIDAEIVLRPLMDFLDKTLSL
SAKICEKTVLKRVLKELWKIVLNRIEKQIVLPPLTDQTGPQMIFSAAKDLGQLSKLKDHV
IRDDAKSLTLRQCAIMEVALATIKVQFYMFFHSVTKYVIT
NT seq 1743 nt NT seq  +upstreamnt  +downstreamnt
atgcctgtgcacttctcctgcctgtcttctaaatatatgtgccctggtgttccagcagtt
atgagtacattgttggccaatataaatgctttctatgctcatactacagcaacaacaaat
gtatctgcctcagacaggtttgcagctactaactttgggagggaaaagttcattaaactt
ctggatcaattgcataattctctgaggattgatttatctaaatatagagataactttcct
gccagcaattctgaaagacttcaagatctgaaatcaactgtggaccttcttaccagcatt
actttttttcgaatgaaggtccttgaattacagagcccacctcgagccagtactgtggtg
aaagactgtgtgagagcctgcctggactcaacatacaaatacatttttgacaattgctat
gatctttactcccaattaatagaccagggtaagaaacaagaagttcctaaagaagaacag
ggaccaacaacaaagaatttggatttctgggcacagcttattactctgatggtcactatt
atagatgaagataaaacagcatacacacctgtcttgaaccagttccctcaggagctgaac
atgggaaaaattagtgctgaaatcatgtggactctgtttgcccaggacatgaagtatgct
ctggaagaacatgaaaatcagcggttatgcaagagcacagattatatgaatttgcacttc
aaagtgaaatggttttataatgaatacgtgcgagagctccatgctttcaaggatgcagtg
cctgaatattctctatggtttgaaccatttgtcattcagtggctggatgaaaatgaggat
gtctcaatggagtttcttcatggagcactggaaagagacaaaaaagatgggtttcagcaa
acatcagaccatgcccttttttcgtgttcagtggttgatgtcttcacacagctcaatcaa
agctttgagattatcaggaaactggagtgtcctaatccagaagcactgtctcatttaatg
agaagatttgcaaagactatcaacaaagtgctgcttcagtatgctgcaattatttcaagt
tacttcagttcatactgtgacaaagaaaatgtgccctgtatcttgatgaacaacattcaa
cagttacgagtgcagcttgaaaaaatgtttgagtccatgggagggaaggagttggatcaa
gaagctagtgctgttctaaaagaacttcaagcaaaacttagcaacgtattggatgaactc
agtgtaacgtatgccacaagtttccaatctattatagaagattgcataagacaaatgagc
tctgaactcaatcaaatgagaggaaatgggactgcagcggccaataagaacagcgcagcc
attgatgcagagattgtacttcggcccctcatggatttcctggacaaaactttaagcctc
tctgcaaaaatctgtgagaagacagttctgaaacgggttctaaaagagttatggaagata
gtcttgaacagaatagaaaaacaaattgtacttccaccgctgacagatcaaactgggccc
cagatgatattcagtgcagccaaagatcttggacaactctcaaaactcaaggaccatgtg
attcgagacgatgccaaaagcctgacgctgaggcagtgtgcaataatggaagtagcacta
gctactataaaggtacagttttacatgtttttccattcagtgaccaagtatgtaattaca
taa

DBGET integrated database retrieval system