KEGG   Meleagris gallopavo (turkey): 100547448Help
Entry
100547448         CDS       T01523                                 

Gene name
EZH1
Definition
enhancer of zeste homolog 1 (Drosophila)
Orthology
K17451  
histone-lysine N-methyltransferase EZH1 [EC:2.1.1.43]
Organism
mgp  Meleagris gallopavo (turkey)
Brite
Enzymes [BR:mgp01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     100547448 (EZH1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
29
AA seq 746 aa AA seqDB search
MEIATPPTSKCIIYWKRKVKSEYMRLRQLKRFQANMGAKALFVANFAKVHEKTQILNEDW
KKLRVQPVQLMKPVSGHPFLKQCTVESIFPGFPSQTLYMRTLNTVALVPIMYSWSPLQQN
FMVEDETVLCNIPYMGDEVKEEDETFIEELINNYDGKVHGEEEMISGSVLISDAVFLELV
NALNQYSDEEEEGHNDSEVKQEDGKEELPVTRKRKRIAVEGNKKCSKKRFPNDMIFTAIS
SMFPEYGFPDDMKERYRELTEVSDPNVLPPQCTPNIDGPCAKSVQREQSLHSFHTLFCRR
CFKYDCFLHPFHATPNVYKRKNRETKIEPDPCGADCFLWLEGAKEFAALHNPRSKCSGRR
RRRHHVVSASCSNAPASAVAETREGDSDRDTGNEWASSSSEANSRCQTPTKQKLSPTSSQ
LFAVEAQQEPVEWTGAEESLFRVFHGTYFNNFCSIARLLGTKTCKQVFQFAVKESLITKL
PTNELMNPSQKKKRKHRLWAAHCRKIQLKKDNSPTQVYNYQPCDHPEHPCDSSCPCIMTQ
NFCEKFCQCNPDCQNRFPGCRCKTQCNTKQCPCYLAVRECDPDLCLTCGASEHWDCKVVS
CKNCSIQRGLKKHLLLAPSDVAGWGTFIKESVQKNEFISEYCGELISQDEADRRGKVYDK
YMSSFLFNLNNDFVVDATRKGNKIRFANHSVNPNCYAKVVMVNGDHRIGIFAKRAIQAGE
ELFFDYRYSQADALKYVGIERETDII
NT seq 2241 nt NT seq  +upstreamnt  +downstreamnt
atggaaatcgccactcctccaacatcaaagtgtattatatactggaaaagaaaagtcaag
tctgaatatatgcgtcttcggcagctcaagagatttcaggcaaacatgggagcaaaggct
ctgtttgtggccaactttgcaaaggttcatgaaaagactcaaattcttaatgaagactgg
aagaaacttcgagttcaaccagtgcagttgatgaagccagtcagtgggcaccccttcctt
aaacagtgtacagttgagagcatttttccaggatttccaagccagacactgtacatgagg
acactgaacacagtggcgctggtgcctatcatgtattcctggtcccctcttcagcagaac
ttcatggtagaggatgaaactgttctgtgcaacatcccttacatgggagatgaggtgaag
gaagaggacgaaaccttcattgaagagcttattaataactatgatgggaaagttcatgga
gaggaagaaatgatttcagggtcagtcctcatcagtgatgctgtcttcctggagctagtg
aatgccctgaatcagtactcagatgaggaagaggaaggacacaatgattctgaagtcaaa
caggaggatgggaaagaggaactgccagtcacaaggaaaagaaaacgaattgcagtggaa
ggtaacaagaagtgttccaagaaacggtttccaaatgacatgatattcactgccatttct
tctatgtttcctgaatatggcttcccagatgacatgaaagagaggtaccgagagctcacg
gaggtgtcggacccgaacgtgctgcccccgcagtgcacccccaacatcgacgggccgtgc
gcgaagtcggtgcagcgggagcagtccctgcactccttccacacgctcttctgccggcgc
tgcttcaaatatgactgttttctgcacccttttcatgctactcctaatgtgtacaaacga
aagaacagagagaccaagattgaaccagatccttgcggagcagactgtttcctctggctg
gaaggagcgaaggagtttgctgcactgcacaatcccaggtccaagtgctcaggcaggcgc
cgccggaggcaccatgtggtcagtgcctcctgttcaaatgccccagcttctgcggttgct
gagacaagggagggagacagcgacagagacacaggcaatgagtgggcttctagttcctcg
gaggcaaactcccgctgtcagacccctaccaagcagaagctgagcccgacctcatcccag
ctgtttgcagtggaggcacagcaggagccagttgagtggacaggagctgaggagtccctc
ttccgtgtcttccatgggacctacttcaacaacttctgctccatcgccagactgctggga
acaaagacatgcaaacaggtctttcagtttgcagtgaaagaatcacttataacaaaactg
ccaacaaatgaattgatgaatccatcccagaagaaaaaaaggaagcacaggctgtgggct
gcccactgcaggaagattcagctgaagaaagataattcacctactcaggtgtacaactac
cagccctgtgaccatcctgaacatccctgtgacagctcctgcccttgcattatgacccaa
aatttctgtgagaagttctgccagtgcaaccctgactgtcagaatcgcttcccgggctgc
cgctgtaagacccagtgcaacaccaagcagtgcccgtgctacttggccgtgcgggaatgc
gatccagacctctgtctgacctgcggggcgtcggagcactgggactgcaaggttgtgtcc
tgcaagaactgcagcatccagcgcggtctcaaaaagcatttgttgctggcaccatcagat
gttgctggctgggggactttcatcaaagaatctgtgcagaagaatgaattcatctctgaa
tactgtggtgagcttatttcacaggatgaggctgaccggcgaggaaaggtctatgacaag
tacatgtcaagtttcctcttcaacctcaacaatgattttgttgttgatgccactcgcaaa
ggaaataaaatccgctttgccaaccactccgtgaaccccaattgctatgccaaagttgtg
atggtgaatggagaccaccggataggaatctttgccaagagggccatccaggcgggagag
gagctcttctttgattaccggtacagccaggcagatgccctgaagtatgttggcatagag
agggagaccgatatcatctga

DBGET integrated database retrieval system