KEGG   Meleagris gallopavo (turkey): 100547472Help
Entry
100547472         CDS       T01523                                 

Definition
3-hydroxybutyrate dehydrogenase type 2-like
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mgp00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    100547472
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    100547472
Enzymes [BR:mgp01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     100547472
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
4
AA seq 245 aa AA seqDB search
MGRLDGKVILLSAAAQGIGKATAIAFAKEGAKVIATDINKTKLQELEKHPGIQIRVLDVT
KRQQIEELAEEIERIDVLCNIAGFVHHGTILDCEERDWNFAMNLNVRSMYLMIKTFLPKM
IKQKSGNIINMSSVASSIKGVVNRCVYSTSKAAVIGLTKSVAADFIEQGIRCNCVCPGTV
DTPSLQERIKAQSNPDQALKDFLARQRIGRMATAEEVAHLFVYLASEESAYMTGNEVVID
GGWSL
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atggggcggctggatgggaaagtaatacttctgtctgctgcagcacaagggattggaaaa
gccactgctatcgcttttgctaaagaaggagccaaagtcattgctacagacatcaataag
actaagctgcaagaactggagaagcatccaggcattcaaatacgggttctggatgtcacc
aaaaggcaacagatagaagagctggcagaggagattgaaaggatagatgtcctctgtaat
attgcagggtttgttcatcatgggaccattctggattgtgaagaacgagactggaacttt
gctatgaacctcaatgttcgcagcatgtatctaatgatcaagacattccttcctaaaatg
attaaacagaaatctggaaatattataaatatgtcttctgtggcatccagcattaaagga
gttgtgaacagatgtgtatatagtacttccaaggcagcagttattggtctaacaaagtct
gtggctgctgatttcattgaacaagggatcagatgcaactgtgtatgtcctggaactgtt
gacacaccatctttacaggaaagaatcaaagcccaatctaacccagaccaggcactgaaa
gatttcctagccagacagaggattggcaggatggctaccgctgaagaagtggcccatctc
tttgtgtacttggcttctgaggaatctgcctacatgactggcaatgaagttgtcattgat
ggaggatggagcttgtga

DBGET integrated database retrieval system