KEGG   Meleagris gallopavo (turkey): 100547495Help
Entry
100547495         CDS       T01523                                 

Gene name
POM121C
Definition
(RefSeq) POM121 transmembrane nucleoporin C
  KO
K14316  
nuclear pore complex protein Nup121
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
RNA transport
Module
Nuclear pore complex
Brite
KEGG Orthology (KO) [BR:mgp00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    100547495 (POM121C)
Messenger RNA biogenesis [BR:mgp03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     100547495 (POM121C)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
21
AA seq 988 aa AA seqDB search
MCIPVLFDVLPIPALLWGSAQPTSCLAPSCPVLEQLLSPVALLPGGSPDPCAKETVLNAI
KESRKRVVEEEEEEEERQALGNDQESKRRRHDSSGSGQSAFEPLVANGAPASLIPKPGSL
KRGLASQCPDDCLNKRSRTSSMSSLNNTYTSGIPSSLRNAIASSYSSSRGLTQLWKRSGV
SVSPLSSPASSRPQTPEWPLKKAREEDLHRSNTSTPVKSDKELQTEKAAVETPVRRKRGS
LSPPAASGSSGKRKRKIQLLSSCRGDQLALPPPPQLGYSITSEDLDAEKKAALQWFNKVL
EDKADPVPISTTAETTPASRPLAFTVTTGTSSAPASTAPVPASSNLLLDSLKKMQDSQAA
PVPADSSGAAIAFQPSSSASQLPGPAVSLESSSLPATSADTKPVSVLSTAALSVSPASGA
QPASSVAPPATTELGPTPSKPPSVLKPNILFGAPSSSPPASQPAMTAAAAVPTTTPVFKP
IFGALPKSESTAPATTVISTAVTVSVSSAPSSAPSTTTVFKPIFGSVTAASSPAKVSPFA
FKPLSQPASAAEVPAASTTTGLAGFTALPNVIFTTAATTATTLNSSTDATIKPVFSFGLN
PPASISTSLTVTATAATSASQPFMFGGLSSSATSTAPTFATPVFQFGKPAAATVSATTSV
AGGPAFGQAPAISAAPTTTVGFSLFGSTTLTSSAPATTGQPAPTFGSSSSAFGSTFSTNV
KPLPPYSGAASQPAFSAGAADSQLPGSKPAAGHVGFAPPFSFGAPTAQSTAQPAFGSSAP
PXFGTGGTQAAFGTTTSVFSFGTPTSTTASFGSGTQTSSSGVGTAVFGTAPSPFTFGAAA
QPGPSAGAFGLSTPALSGGSPAVPFSFGAGQSGAAAAATPFGSSLTQSALGAPSQSTPFA
FTVPSTPDAKPVFGGTPAPTFGQSTPVPGAVGSGSSSLSFGTPSAPASAFPGVGTSFGPS
TPAFSIGAGSKTGARQRLQARRQHTRKK
NT seq 2967 nt NT seq  +upstreamnt  +downstreamnt
atgtgtattcctgttctgtttgacgttctccccatcccggccctgctgtggggctcagct
cagcccacgtcctgcctggctccaagctgccccgtgctggagcagctcctctcgccggtt
gccctcctgcccggcggcagcccggacccgtgcgcgaaggagacggtactgaacgccatc
aaggagagcaggaagagggtggtggaggaggaggaagaggaggaggagcggcaggcgctg
ggtaatgatcaggagagcaaacgaaggcgccatgacagcagtggaagcgggcagtcagca
ttcgagcccctggttgccaacggtgcccccgcctctctcatacccaagcctggctctctg
aagagaggccttgcttcgcagtgccctgatgactgcttaaacaagaggtcacgcacctcc
tccatgagctccctcaacaatacatacactagtggaatccccagctccctgcgcaatgcc
atcgccagctcatacagctccagccggggcctgacacagctgtggaagaggagtggtgtg
agcgtgtccccgctgtccagccccgcatcctcccgtccccagacaccagagtggcctctc
aagaaagccagggaggaggatttgcatcgttccaacacttccaccccagtgaaatcggat
aaggagctgcagacagagaaagcagcggtggagacacccgtgcggaggaagcgcggttcc
ctgagccctccagctgcatcggggagcagtggcaagcgcaagcggaagatccagttgctg
tcgtcctgccggggggaccagctggcactgcccccgccgcctcagctgggctactccatc
acgtcggaggacctagatgcggagaagaaggcagcgttgcagtggttcaacaaagtcttg
gaggataaggctgatccagtccccattagcaccactgcagagaccacgcctgcatccagg
ccattagcattcacagtgaccacagggacctcctcagcgcctgcgtcaacagctcctgtc
ccagccagcagcaacttgctcctggacagcctgaagaagatgcaggacagccaggctgca
cctgtgccagcagactcttctggagctgcgatagcattccagccatcttcatcagcatca
cagctgcctggtcctgccgtgtcactggagtcaagttctcttcctgcgacctctgctgac
accaagcctgtgtctgtgctaagcacggctgccctttccgtctcccctgcctcgggggca
cagcctgccagcagcgtggcacctcccgcaaccacagagctgggcccaacccccagcaaa
cctccctccgtgctgaagccgaacatcctttttggggcaccaagctcctcccctcctgcc
agccagccagcaatgactgcagctgctgcggtgcccactactacccctgtcttcaagccc
atctttggtgctttgccgaaaagtgagagcacagcaccagctacaacagtcatctctact
gcagtcactgtgtctgtgagctcagccccttcctcagcaccttccaccaccaccgtgttc
aagcccatctttggcagcgtgacagcagcttcatctccagcaaaagtctctccttttgcc
ttcaaaccgttgtcacagccagcttcagctgcagaagtgccagcagcctccacaaccaca
ggattggcaggattcacagctctgccaaacgtcatcttcaccaccgcagctacgactgcc
accacgctcaactcctccacggatgccaccattaagccagtgttcagctttggactcaac
ccgcctgcctccatcagcaccagcctgacagtgaccgccaccgcagccaccagcgcgtcg
cagcccttcatgtttggtggcctgtccagctctgccaccagcacggcacccacctttgct
accccggtgtttcagtttggaaagcccgctgcagccactgtctctgccaccaccagtgtc
gcaggaggccctgcgtttggccaagcacctgcaatctcagcagcacctaccaccactgtg
ggcttcagcttatttggaagcaccacgttgacatcttctgccccggccaccacaggccaa
ccggcgccgacatttggctcctccagttcagctttcggcagtacattcagcacaaatgtg
aagccactgccgccgtattcaggggcagcgagccagcccgcattcagcgccggtgctgca
gacagccagctgcccggcagcaagcccgctgcgggccacgtcggctttgctcccccgttc
agttttggggcgcccacggcccagtccaccgctcagccggcgtttggcagcagcgctccg
ccgnacttcggcaccggcggcacccaggcggcatttgggaccaccacatcagtgttctcc
tttgggacgcccacctctaccacagccagcttcggttccggcacccagacctcaagcagc
ggcgtaggcactgccgtcttcggcaccgcgccatctcctttcaccttcggggcagccgcc
cagccgggcccttctgccggagcctttgggctcagcacacccgccctgagcggtggctca
cccgcagtgcccttcagctttggggctgggcagagcggagctgctgcagctgccacaccg
ttcggttcttctctgacgcagagcgcgctgggagcgccgagccagagcacgccgttcgcc
ttcactgtgcccagcacacccgatgccaagcccgtgtttggaggaactcctgcccccacc
tttgggcagagcacgcctgtcccaggagcagtggggagtggcagcagcagcctttccttc
gggacgcccagcgctcctgcctcagccttcccaggagttggcacgtcctttggtccatca
accccagcattttccatcggggcaggatccaagaccggcgctcgccagcggctgcaggca
cggcgacagcacacccgtaaaaagtaa

DBGET integrated database retrieval system