KEGG   Meleagris gallopavo (turkey): 100547495Help
Entry
100547495         CDS       T01523                                 

Definition
nuclear envelope pore membrane protein POM 121-like
Orthology
K14316  
nuclear pore complex protein Nup121
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:mgp00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    100547495
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
21
AA seq 974 aa AA seqDB search
MGKVLGSLLGNICFQRHGMGQGGTEGSGSSQHAPKPQRAALPCLCPQLCPLSCRRHDSSG
SGQSAFEPLVANGAPASLIPKPGSLKRGLASQCPDDCLNKRSRTSSMSSLNNTYTSGIPS
SLRNAIASSYSSSRGLTQCKPLCSSVLAQRTRLQWEKLQSELELTQPCALKGEEPVSRGI
SHPELLVATPREEDLHRSNTSTPVKSDKELQTEKAVETPVRRKRGSLSPPAASGSSGKRK
RKIQLLSSCRGDQLALPPPPQLGYSITSEDLDAEKKAALQWFNKVLEDKADPVPISTTAE
TTPASRPLAFTVTTGTSSAPASTAPVPASSNLLLDSLKKMQDSQAAPVPADSSGAAIAFQ
PSSSASQLPGPAVSLESSSLPATSADTKPVSVLSTAALSVSPASGAQPASSVAPPATTEL
GPTPSKPPSVLKPNILFGAPSSSPPASQPAMTAAAAVPTTTPVFKPIFGALPKSESTAPA
TTVISTAVTVSVSSAPSSAPSTTTVFKPIFGSVTAASSPAKVSPFAFKPLSQPASAAEVP
AASTTTGLAGFTALPNVIFTTAATTATTLNSSTDATIKPVFSFGLNPPASISTSLTVTAT
AATSASQPFMFGGLSSSATSTAPTFATPVFQFGKPAAATVSATTSVAGGPAFGQAPAISA
APTTTVGFSLFGSTTLTSSAPATTGQPAPTFGSSSSAFGSTFSTNVKPLPPYSGAASQPA
FSAGAADSQLPGSKPAAGHVGFAPPFSFGAPTAQSTAQPAFGSSAPPTFGTGGTQAAFGT
TTSVFSFGTPTSTTASFGSGTQTSSSGVGTAVFGTAPSPFTFGAAAQPGPSAGAFGLSTP
ALSGGSPAVPFSFGAGQSGAAAAATPFGSSLTQSALGAPSQSTPFAFTVPSTPDAKPVFG
GTPAPTFGQSTPVPGAVGSGSSSLSFGTPSAPASAFPGVGTSFGPSTPAFSIGAGSKTGA
RQRLQARRQHTRKK
NT seq 2925 nt NT seq  +upstreamnt  +downstreamnt
atgggcaaggtgctcggctcactgctgggcaacatctgcttccagaggcacgggatgggc
cagggtggcacagaggggtcagggagcagccagcacgccccaaagccgcagcgagcggcc
ctgccatgcctctgtccccagctctgccctctctcctgcaggcgccatgacagcagtgga
agcgggcagtcagcattcgagcccctggttgccaacggtgcccccgcctctctcataccc
aagcctggctctctgaagagaggccttgcttcgcagtgccctgatgactgcttaaacaag
aggtcacgcacctcctccatgagctccctcaacaatacatacactagtggaatccccagc
tccctgcgcaatgccatcgccagctcatacagctccagccggggcctgacacagtgcaag
cccttgtgctcctctgtcctggctcagaggaccaggctccagtgggaaaagcttcagtca
gaactagaactgacacagccttgtgcactgaaaggagaggagcctgtgagccgtggcatt
tcccatccagaactgctggttgccaccccgagggaggaggatttgcatcgttccaacact
tccaccccagtgaaatcggataaggagctgcagacagagaaagcggtggagacacccgtg
cggaggaagcgcggttccctgagccctccagctgcatcggggagcagtggcaagcgcaag
cggaagatccagttgctgtcgtcctgccggggggaccagctggcactgcccccgccgcct
cagctgggctactccatcacgtcggaggacctagatgcagagaagaaggcagcgttgcag
tggttcaacaaagtcttggaggataaggctgatccagtccccattagcaccactgcagag
accacgcctgcatccaggccattagcattcacagtgaccacagggacctcctcagcgcct
gcgtcaacagctcctgtcccagccagcagcaacttgctcctggacagcctgaagaagatg
caggacagccaggctgcacctgtgccagcagactcttctggagctgcgatagcattccag
ccatcttcatcagcatcacagctgcctggtcctgccgtgtcactggagtcaagttctctt
cctgcgacctctgctgacaccaagcctgtgtctgtgctaagcacggctgccctttccgtc
tcccctgcctcgggggcacagcctgccagcagcgtggcacctcccgcaaccacagagctg
ggcccaacccccagcaaacctccctccgtgctgaagccgaacatcctttttggggcacca
agctcctcccctcctgccagccagccagcaatgactgcagctgctgcggtgcccactacg
acccctgtcttcaagcccatctttggtgctttgccgaaaagtgagagcacagcaccagct
acaacagtcatctctactgcagtcactgtgtctgtgagctcagccccttcctcagcacct
tccaccaccaccgtgttcaagcccatctttggcagcgtgacagcagcttcatctccagca
aaagtctctccttttgccttcaaaccgttgtcacagccagcttcagctgcagaagtgcca
gcagcctccacaaccacaggattggcaggattcacagctctgccaaacgtcatcttcacc
accgcagctacgactgccaccacgctcaactcctccacggatgccaccattaagccagtg
ttcagctttggactcaacccgcctgcctccatcagcaccagcctgacagtgaccgccacc
gcagccaccagcgcgtcgcagcccttcatgtttggtggcctgtccagctctgccaccagc
acggcacccacctttgctaccccggtgtttcagtttggaaagcccgctgcagccactgtc
tctgccaccaccagtgtcgcaggaggccctgcgtttggccaagcacctgcaatctcagca
gcacctaccaccactgtgggcttcagcttatttggaagcaccacgttgacatcttctgcc
ccggccaccacaggccaaccggcgccgacatttggctcctccagttcagctttcggcagt
acattcagcacaaatgtgaagccactgccgccgtattcaggggcagcgagccagcccgca
ttcagcgccggtgctgcagacagccagctgcccggcagcaagcccgctgcgggccacgtc
ggctttgctcccccgttcagttttggggcgcccacggcccagtccaccgctcagccggcg
tttggcagcagcgctccgccgactttcggcaccggcggcacccaggcggcatttgggacc
accacatcagtgttctcctttgggacgcccacctctaccacagccagcttcggttccggc
acccagacctcaagcagcggcgtaggcactgccgtcttcggcaccgcgccatctcctttc
accttcggggcagccgcccagccgggcccttctgccggagcctttgggctcagcacaccc
gccctgagcggtggctcacccgcagtgcccttcagctttggggctgggcagagcggagct
gctgcagctgccacaccgttcggttcttctctgacgcagagcgcgctgggagcgccgagc
cagagcacgccgttcgccttcactgtgcccagcacacccgatgccaagcccgtgtttgga
ggaactcctgcccccacctttgggcagagcacgcctgtcccaggagcagtggggagtggc
agcagcagcctttccttcgggacgcccagcgctcctgcctcagccttcccaggagttggc
acgtcctttggtccatcaaccccagcattttccatcggggcaggatccaagaccggcgct
cgccagcggctgcaggcacggcgacagcacacccgtaaaaagtaa

DBGET integrated database retrieval system