KEGG   Meleagris gallopavo (turkey): 100547528Help
Entry
100547528         CDS       T01523                                 

Definition
delta-1-pyrroline-5-carboxylate synthase-like
Orthology
K12657  
delta-1-pyrroline-5-carboxylate synthetase [EC:2.7.2.11 1.2.1.41]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:mgp01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:mgp00330]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
8
AA seq 800 aa AA seqDB search
MSCRAALSPLVRSPGWCFVLPPHGIAAISRLYLPHHTHSLRNESIRCWSNIPFITMPLSR
AHGKSFAHRSELKHAKRIVVKLGSAVVTRGDECGLALGRLASIVEQVSVLQNQGREMMIV
TSGAVAFGKQRLRHEILLSQSVRQALHSGQSQLKDMAIPVLEARACAAAGQSGLMALYEA
MFTQYSICAAQILVTNLDFHDEQKRRNLNGTLHELLRMNIVPIINTNDAVVPPPEPNSDL
QGVISVKDNDSLAARLAVEMKTDLLIVLSDVEGLFNSPPGSDDAKLIDIFYPGDQQSVTF
GTKSRVGMGGMEAKVKAALWALQGGTSVVIANGTHPKISGHVITDIVEGKKVGTFFSEVK
PAGPTVEQQGEMSRAGGRTLAALQPEQRAEIIYRLADLLTDQREEILLANKKDLEEAENK
GRLALPLLKRLSLSTSKLNSLAIGLRQIAASSQDSVGRIIRRTRIAKDLELEQVTVPIGV
LLVIFESRPDCLPQVSALAIASGNGLLLKGGKEAAYSNQILHHLTQEALSIHGVKDAVQL
VNTREEVEDLCRLDKLIDLIIPRGSSQLVRNIQKAAKGIPVMGHSEGICHVYVDTDASVE
KVTRIIRDSKCEYPAACNAVETLLIHRDLLRTPLFDQIIDMLRVEQVKIHAGPKFASYLT
FSPSEVKSLRTEYGDLECCIEVVDSVQEAVEHIHKYGSSHTDVIITENEKTAEFFLQHVD
SACVFWNASTRFSDGYRFGLGAEVGISTSRIHARGPVGIEGLLTTKWLLRGDNHVVSDFS
EHGSMKYLHESLPVPHRNTS
NT seq 2403 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtgtcgagccgctctgagccctcttgtccgttcccctggatggtgctttgtgtta
ccgccgcatggcatcgcagccatttcccgtctctatctccctcaccatacccacagttta
aggaatgaatccatccgttgttggagcaacatcccatttatcaccatgccactcagccgt
gcacatggcaaatcatttgcacaccgcagtgagctgaagcacgcaaagcggattgtcgtg
aagttgggcagtgctgttgtgacaagaggggatgagtgtggcttagcccttggaaggctg
gcatctattgtggagcaggtgtcagtgctgcagaatcagggccgagagatgatgattgtc
accagtggtgctgtagcttttggaaaacagagattgcgtcacgagatcttgctttctcag
agtgtgaggcaagcacttcattcaggccaaagtcagctaaaagatatggctattccagtc
ctggaagctcgagcctgtgcagcagctggccagagtggactgatggccctgtatgaagcc
atgtttacacagtacagcatctgtgcagctcaaattttagtcaccaatttggatttccat
gatgaacagaagcggcggaacttaaatggaacgctacatgagcttttaagaatgaatatt
gtcccgataattaacactaatgatgctgttgttccacctccagaaccaaacagtgatcta
cagggggtgattagtgtgaaggataatgacagtttggcagcacgtctggctgtcgaaatg
aagaccgatctccttattgttctttcagatgtagaaggactcttcaacagccctccagga
tctgatgatgcaaagctcattgacatattctacccaggagaccagcagtctgtgacattt
ggaaccaaatctcgagtgggaatgggaggcatggaagccaaggtcaaagcagctctgtgg
gccctccaaggaggcacttctgtagtgattgcaaatggaactcacccaaagatctctggt
cacgtcatcacagatattgtggaagggaaaaaagttggaacttttttttcagaggtaaag
cctgcaggccctacagtagagcagcaaggtgaaatgtctcgagctggtggcaggaccctg
gcagcactgcagcctgagcagagagcagagattatttatcgtcttgctgacttactaact
gatcaaagagaagaaatcctcttggcaaacaagaaggacttagaagaagcagaaaataaa
gggagactggcacttcctttgttgaaacgtctaagtctctctacatcaaagctgaacagc
ttggctattggactacgtcagattgcagcttcctcacaggacagcgtcggccgcataatt
cggagaacaagaatagcaaaagacctggaattggagcaggtgacagtgcctattggggtt
cttctcgtgatttttgagtctcgccctgactgtctcccacaggtatctgctttggccatt
gctagtggaaatggtttgctacttaaaggaggaaaagaggcagcctatagcaatcaaatc
cttcatcatctgacacaagaagcactttcaattcatggagtcaaagatgcagtgcaactg
gtgaatacaagagaggaggtagaagatctctgccgtttggacaagctgatagatctaatc
attccacgtggttcatcccagctagtcaggaatatacagaaagcagcaaagggaatacct
gtgatgggacacagcgaaggaatctgtcatgtgtatgtggacacggacgccagtgttgaa
aaggtcacgcgaataatcagagactcaaagtgtgaatatcctgctgcctgtaatgctgtg
gaaacactcttaattcatcgagacttgctgagaaccccgttgtttgatcagatcatagac
atgttgagagtagaacaggtgaagattcatgctggcccaaaatttgcctcttacttgacg
ttcagcccctctgaagtgaaatctctccgcactgaatatggagacctggagtgctgcatt
gaggttgtggacagtgtccaggaggctgttgaacatatccacaagtatggaagctctcac
acggatgttatcatcacagaaaatgagaaaacagcagagttcttcctccagcatgtggac
agcgcttgtgttttctggaatgccagcacccgattctctgatgggtatagatttggactt
ggtgctgaagttggaattagtacttctcgtatccatgcacgtggaccagtaggaattgaa
ggactcttaactacaaagtggttgttgagaggggacaatcatgttgtttctgacttctca
gagcatggcagcatgaaatatcttcatgagagcctccctgtgcctcacagaaataccagc
taa

DBGET integrated database retrieval system