KEGG   Meleagris gallopavo (turkey): 100547553Help
Entry
100547553         CDS       T01523                                 

Gene name
MAPK15
Definition
(RefSeq) mitogen-activated protein kinase 15
  KO
K19603  
mitogen-activated protein kinase 15 [EC:2.7.11.24]
Organism
mgp  Meleagris gallopavo (turkey)
Brite
Enzymes [BR:mgp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     100547553 (MAPK15)
Protein kinases [BR:mgp01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   100547553 (MAPK15)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
3
AA seq 592 aa AA seqDB search
MHRTSSALSKHLPVNASSREASCSGRYDPASHTVKAYGIVWKAINRRTGEIVAVKKIFDA
FRNRTDAQRTFREIMFLREFGEHPNIIKLLDVIRAENNKDIYLIFESMETDLHAVIKKGN
VLKDIHKSYILYQLLKATKFIHSGNVIHRDQKPSNILLDADCFVKLCDFGLARSLCQVDE
EQSSPALTEYVATRWYRAPEILLSSRSYTKGVDMWSIGCILGELLLGKPLFPGTSTINQI
EQILRVIPAPSSEDIMAMQSDYRASIIDGMSSRQRVTFEEILPSSTPLPALDLLKKLLVF
NPDKRLTAEEALQHPYVKRFHCPAREPSLGRDVILPLGDDTQLSVAEYRNKLYEMILEKK
VNSHPKEQMQRGDTELGQSHPRPFFPYSSPATLTTRKSPGMPSPPLPEHPHTDAGSAASV
LAEVPGQSKGFSASSCHRSQISVIHNPITRSAVQRRYCHHAGDANSGAVIRNHSAPPPQQ
ARTASNGKQRRQIAWANANTQLPASAQNLSCNPRNTQFHSKDVHPLPKCSKKMFHITANV
GAAGDPKASMGSYSQAYGTICQSALQSLPIPNSSQAHEEPIWKRSNQASSAP
NT seq 1779 nt NT seq  +upstreamnt  +downstreamnt
atgcacagaacgagcagcgcgctttccaagcaccttcccgtcaacgccagcagcagagaa
gccagctgcagcggcagatatgaccctgcttcgcataccgtcaaggcttatggcattgtg
tggaaagcaattaatcgcaggacaggagaaatagttgcagttaaaaagatttttgatgct
ttcaggaacagaacagatgctcagagaacatttcgtgagattatgttcctacgggaattt
ggagagcatccaaatatcatcaagctgcttgatgttatccgagctgagaacaacaaggac
atctacctcatttttgagtctatggagacagatttgcatgctgtgattaagaaggggaat
gtactgaaagacatccacaagtcttacattctctatcaactcctgaaagccactaagttc
atccattcaggaaatgttattcacagggatcagaagccttcgaatatcttgctggatgca
gactgctttgtgaagctctgtgattttgggctggcccggtctttgtgtcaggtggacgaa
gaacaaagcagccctgccttaacagagtacgtggccacgcgctggtaccgagcccctgag
atcctgctctcctcccggagctacactaaaggggtagacatgtggagcattggctgcatt
ctgggcgagctgcttcttggaaaacctctttttcctggaacatcaaccatcaatcaaata
gagcagatcttgagggtcattcctgccccatcctcagaagatattatggctatgcaatca
gactacagggcctcgattattgacggcatgagttcccggcagcgggtaacgtttgaggag
attctaccatcctctactcctttgcctgccttagatcttctgaagaagcttttagtgttt
aaccctgataaacgactgacggcagaggaggccctccagcatccgtatgtgaaaaggttt
cattgccctgccagggagccctcgctgggtcgtgatgtgatccttcctttaggtgatgac
actcagctgtccgtggcagaatatcggaacaagttgtatgagatgatcctcgaaaagaaa
gtaaatagccatccaaaggagcaaatgcagagaggagacactgaactgggtcagtctcac
cccagaccattctttccatattccagtcccgcgactttaaccaccaggaagagccccgga
atgccatcaccacctctgccagaacatccgcacacggatgctggaagtgcagccagtgtc
ctggcagaggtacccggccagagcaaaggcttctcagcatcttcgtgtcacagatcacag
atcagtgtgatacacaaccccataacacgctctgctgttcagaggaggtactgccatcac
gcaggtgatgcaaattctggtgctgtgatcaggaaccattctgcaccacctcctcagcag
gcaagaactgccagcaatgggaagcagaggagacaaattgcgtgggcaaatgcaaatact
cagcttcctgcaagcgcacagaacctttcctgcaacccacgaaatactcaatttcacagc
aaagatgtccacccccttccgaagtgcagtaaaaagatgttccatattactgccaacgtg
ggagccgccggcgatccgaaggcatccatgggcagttattctcaggcctacggaaccatc
tgccagtctgcactgcagagtcttccgataccaaactcctcccaggcacacgaggagcca
atatggaagagatcaaaccaggcctcgtcagccccctga

DBGET integrated database retrieval system