KEGG   Meleagris gallopavo (turkey): 100547667Help
Entry
100547667         CDS       T01523                                 

Gene name
PLCB4
Definition
(RefSeq) phospholipase C beta 4
  KO
K05858  
phosphatidylinositol phospholipase C, beta [EC:3.1.4.11]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
Inositol phosphate metabolism
Metabolic pathways
Calcium signaling pathway
Phosphatidylinositol signaling system
Adrenergic signaling in cardiomyocytes
Vascular smooth muscle contraction
Wnt signaling pathway
Apelin signaling pathway
Gap junction
NOD-like receptor signaling pathway
GnRH signaling pathway
Melanogenesis
AGE-RAGE signaling pathway in diabetic complications
Module
Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:mgp00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100547667 (PLCB4)
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    100547667 (PLCB4)
   04371 Apelin signaling pathway
    100547667 (PLCB4)
   04020 Calcium signaling pathway
    100547667 (PLCB4)
   04070 Phosphatidylinositol signaling system
    100547667 (PLCB4)
 Cellular Processes
  Cellular community - eukaryotes
   04540 Gap junction
    100547667 (PLCB4)
 Organismal Systems
  Immune system
   04621 NOD-like receptor signaling pathway
    100547667 (PLCB4)
  Endocrine system
   04912 GnRH signaling pathway
    100547667 (PLCB4)
   04916 Melanogenesis
    100547667 (PLCB4)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100547667 (PLCB4)
   04270 Vascular smooth muscle contraction
    100547667 (PLCB4)
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    100547667 (PLCB4)
Enzymes [BR:mgp01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     100547667 (PLCB4)
Membrane trafficking [BR:mgp04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    100547667 (PLCB4)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    100547667 (PLCB4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Ensembl: 
Position
2
AA seq 646 aa AA seqDB search
MASYKYVGATTNIHPYLSTMVNYAQPVKFQGFDIAEERNIHHNMSSFNESVGLGYLKTHA
IEFVNYNKRQMSRIYPKGGRVDSSNYMPQIFWNAGCQMVSLNYQTPDLAMQLNQGKFEYN
GSCGYLLKPDFMRRPDRTFDPFSETPVDGVIAATCSVQVISGQFLSDKKIGTYVEVDMYG
LPTDTIRKEFRTRMVMNNGLNPVYNEESFVFRKVILPDLAVLRIAVYDDNNKLIGQRILP
LDGLQAGYRHISLRNEGNKPLSLPTVFCNIVLKTYVPDGFGDIVDALSDPKKFLSITEKR
ADQMRAMGIETSDIADVPNDTSKNDRKGKANNAKANVTPQSSSELRPSTTAGFGSGTDAK
KGIDLIPQVKIEDLKQMKAYIKHLKKQQKELNALKKKHAKEHSAMQKLHCTQIDKIVAQY
DKEKVSYEKMLEKAIKKKGGSNCVELKKETEIKIQALTSDHKSKVKEIVAQHTKEWSEMI
NTHSAEEQEIRDLHLNQQCELLKKLLINAHEQQTQQLKFSHDRESKEMRANQAKISMENS
KAISQDKSIKNKAERERRVRELNSSNTKKFLEERKRLAMKQSKEMDQLKKVQLEHLEVLE
KQNEQLLKSCHAVSQTQGKGDAADGEAGSRDGSQASNSGLKPQHAN
NT seq 1941 nt NT seq  +upstreamnt  +downstreamnt
atggcatcttataaatatgtaggtgccacaaccaacatacatccgtatttatcaacaatg
gtcaactatgctcagcctgtaaaatttcaaggtttcgacatagcagaagaacgtaatatt
catcataacatgtcttctttcaatgaatcagttggactagggtatttgaagactcatgcc
attgagtttgtgaattataataaacgacaaatgagtcggatatacccaaagggaggccga
gtggattccagtaattacatgcctcaaattttctggaacgctggctgccagatggtctca
ctgaactatcagaccccagatttagcaatgcagttgaatcaaggaaaatttgaatataat
ggatcatgtggctatctacttaaaccagatttcatgcgccgaccggatagaacatttgac
cctttctctgaaactcctgtagatggtgtaattgctgcaacgtgttctgtacaggtaata
tctggtcagtttttatcagataaaaagattggtacgtatgtagaagtggatatgtacggc
ttacccacggacacaatacgtaaagaatttagaacacgcatggtgatgaacaacggtctg
aaccctgtttacaatgaagaatcatttgtatttcgaaaggttattctccctgatcttgct
gtcctgagaatagcagtatatgatgacaataataagttgatcggtcagaggatcctgcct
ctagatggtctacaagcaggttacagacacatttcacttcgaaatgagggcaacaaacca
ctctctcttccgacggttttctgcaacattgtgcttaaaacatatgtgcctgatggtttt
ggagatattgtggatgctttgtcagatccaaagaaatttttgtctattacagaaaaaaga
gcagaccaaatgagagctatgggtattgaaactagtgatatagctgatgtaccaaatgac
acttcaaaaaatgatagaaaagggaaagctaataacgccaaagcaaacgtgactcctcag
agtagctctgagcttcgaccaagtaccacagcaggctttgggtctgggaccgatgctaag
aaaggtatagacctaattcctcaagtgaagatagaagatttaaagcaaatgaaggcttac
ataaaacatttaaagaaacagcagaaagagctgaatgccttaaagaagaagcatgcaaag
gagcacagcgctatgcagaagttgcactgcacacaaattgacaaaatagtggcacaatat
gataaagaaaaggtatcatacgagaaaatgttagagaaggcaatcaagaagaagggagga
agtaattgtgttgaattgaagaaagaaactgaaattaaaattcaggcactaacgtcagat
cacaagtctaaggtcaaagagattgtggcacagcacactaaagagtggtctgagatgatc
aatacgcatagtgcggaagagcaagaaatccgtgatttacacttgaaccaacagtgtgaa
ctactgaagaaactgctgattaatgctcatgaacaacagacccagcagctaaaattttca
catgacagggaaagcaaggagatgcgtgcaaaccaggcaaaaatatctatggagaacagc
aaagccataagccaagataaatctatcaaaaacaaagcagaaagagagaggcgagtcaga
gaattgaacagcagcaacacgaaaaaattcctggaagagagaaaaaggcttgcaatgaaa
cagtcaaaggaaatggatcagttgaaaaaagttcagcttgagcatttagaagtcttggaa
aagcagaatgagcagcttttgaaatcctgtcatgcagtgtctcaaacacaaggcaaagga
gatgcagcagatggtgaagctggaagcagagatggatcgcaggccagcaacagtggtcta
aagcctcaacatgcaaattga

DBGET integrated database retrieval system