KEGG   Meleagris gallopavo (turkey): 100547785Help
Entry
100547785         CDS       T01523                                 

Definition
brain-derived neurotrophic factor-like
Orthology
K04355  
brain-derived neurotrophic factor
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
MAPK signaling pathway
Brite
KEGG Orthology (KO) [BR:mgp00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    100547785
Cytokines [BR:mgp04052]
 PDGF family
  Cysteine-knot growth factors
   Subclass II
    100547785
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
5
AA seq 246 aa AA seqDB search
MTILFLTMVISYFSCMKAAPMKEASVRGQGSLAYPGLRTHGTLESLNGPNAGSRGLTSLA
DTFEHVIEELLDEDQDIQPSEENKDADLYTSRVMLSSQVPLEPPLLFLLEEYKNYLDAAN
MSMRVRRHSDPARRGELSVCDSTSEWVTAAEKKTAVDMSGATVTVLEKVPVPKGQLKQYF
YETKCNPKGYTKEGCRGIDKRHWNSQCRTTQSYVRALTMDNKKRVGWRFIRIDTSCVCTL
TIKRGR
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgaccatccttttccttactatggttatctcatacttcagttgcatgaaagctgccccg
atgaaagaagctagtgtaagaggacaaggcagcttggcttacccaggtcttcggacccac
gggacacttgaaagccttaatgggcccaacgctggttcaagaggactgacgtcgctggcg
gacacttttgaacacgtgatagaggagcttctagatgaggatcaggacatccagcccagt
gaggaaaacaaggacgcggacttgtacacatcccgagtcatgctgagcagtcaagtgcct
ttggaacccccgctgctttttctgcttgaggagtacaaaaactacctggatgctgcaaac
atgtccatgagagtccggcgtcactctgacccagctcgccgtggggaactgagcgtctgt
gacagcacgagcgagtgggtaacggcggcggagaaaaagactgcagtggacatgtccggt
gcgaccgtcacagtccttgaaaaagtcccagtacctaaaggccaactgaagcaatacttc
tacgagaccaaatgcaaccccaaggggtacacaaaggaaggctgcaggggcatagacaag
aggcactggaactcgcagtgccgaactacccagtcttacgtgagagctctcaccatggat
aacaaaaagagagttggctggcggtttataagaatagacacttcctgtgtatgtacatta
accattaaaaggggaagatag

DBGET integrated database retrieval system