KEGG   Meleagris gallopavo (turkey): 100547794Help
Entry
100547794         CDS       T01523                                 

Definition
cytochrome P450 2J2-like
Orthology
K07418  
cytochrome P450, family 2, subfamily J [EC:1.14.14.1]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
Arachidonic acid metabolism
Linoleic acid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mgp00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    100547794
   00591 Linoleic acid metabolism
    100547794
Enzymes [BR:mgp01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     100547794
Cytochrome P450 [BR:mgp00199]
 Cytochrome P450, animal type
  CYP2 family
   100547794
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
10
AA seq 493 aa AA seqDB search
MLRFLWDSVSLQMLFVFLFVFLLVADYMKRRKPKDFPPSPFALPFLGNVQFMIAKDPVAV
AQKIIEEHGDIFSMQVGTQSFVILNGLQMIKEALLIQGENFMDRPEIPINTEVFNKLGLI
SSNGHLWKQQRRFTLITLRNFGLGKRSLEERIQEECRFLTDAFRDEQGNPFNPHLKINSA
VSNVICSITFGNRFEYHNGNFQNLLRLMDETVILHGKIMSQVHLYNVFPSIIKYFPGSHQ
TIFENWRLMKGFVKEKISKHKEDLNPSESRDFIDSYLQEMAKSNGSDFCEDNLVACTLDL
FFAGTETTSTTIRWALLFMALYPEIQARVQAEIDAVIGQCRQPALEDRNNMPYTNAVIHE
VQRKGNITPFSLPREAKKDTVLAGFHLPKGSIVVPNLSSVMLDKKEWETPHSFNPGHFLK
DGQFWKREAFMPFSIGKRACLGELLARAELFLFFTALLQKFTFQAPRDTILDLKFILGMT
LAPRPYKICAVPR
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atgctgcgcttcctgtgggacagcgtctccctgcagatgctcttcgtcttcctctttgtc
ttcctgctcgtcgctgactacatgaagaggagaaagccgaaggacttcccccccagtcct
tttgccctgccattcctgggaaatgtgcaatttatgattgccaaagaccccgtggctgtg
gcacagaagattattgaagaacatggagatatctttagcatgcaagtaggcactcagtct
tttgtgatcttaaatgggctgcaaatgatcaaggaagcccttctgatccagggagagaac
ttcatggatcgcccagaaattcctatcaacacagaggttttcaacaaattggggctgatc
tcctccaatgggcacctgtggaagcagcagagaaggttcaccttgatcaccctccgaaac
tttggcttggggaagaggagcctggaggagcggatccaggaggagtgccgattcctcaca
gatgcgttcagggatgagcagggaaatcctttcaaccctcaccttaaaatcaacagtgct
gtttcaaatgttatctgttccatcacctttggcaatcggtttgaataccataatggaaac
ttccaaaacttgctgcggctgatggatgagactgttatcctccatgggaaaataatgagc
caggtacatctctacaatgtctttccctccattataaagtacttcccaggatctcaccaa
accatttttgaaaactggaggctcatgaaaggttttgtgaaagagaagatcagcaaacac
aaggaagacctgaacccatcagagagccgagacttcattgacagctacctgcaggagatg
gccaagtccaatggcagtgatttctgtgaggataacctggttgcatgcactctcgatctg
ttttttgctgggactgagacaacctccacaaccatccgctgggccctactgtttatggcc
ttatatccagaaattcaagcccgtgtgcaagccgagatcgatgctgtcattgggcagtgc
cggcagccagccctggaggacaggaacaacatgccctacaccaacgccgtcatccatgaa
gtgcagaggaaaggcaacatcacccctttcagtttgcctagagaggcaaagaaggacaca
gtcctggctggtttccacctgcccaagggctctattgtagtcccgaatctatcctctgtg
atgcttgacaagaaggaatgggaaacccctcacagttttaaccccgggcatttcctgaag
gacggtcagttctggaaaagggaggcttttatgccattttctatagggaagcgcgcctgc
ctgggtgagctgctggcccgcgccgagctcttcctcttcttcacggctctgctccagaaa
ttcaccttccaggctccccgggacaccatcctcgacctcaaattcattctgggcatgacc
ttggccccgcggccctacaagatctgtgcagtgcctcggtag

DBGET integrated database retrieval system