KEGG   Meleagris gallopavo (turkey): 100547998Help
Entry
100547998         CDS       T01523                                 

Gene name
CYLD
Definition
(RefSeq) cylindromatosis (turban tumor syndrome)
  KO
K08601  
ubiquitin thioesterase CYLD [EC:3.4.19.12]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
RIG-I-like receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:mgp00001]
 Organismal Systems
  Immune system
   04622 RIG-I-like receptor signaling pathway
    100547998 (CYLD)
Enzymes [BR:mgp01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100547998 (CYLD)
Peptidases [BR:mgp01002]
 Cysteine Peptidases
  Family C67
   100547998 (CYLD)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
13
AA seq 686 aa AA seqDB search
MADNPIGNWDGRYNGIQLCSFASVESTLLLHINDVIPETVSQDRRPPKLAYTARGGGDKG
VFNHSKPKATGSTSEPGNRNRSEVFYTLNGSSVDSQPQAKTKPPWYIDEVAEDPAKSLTD
SSPGFGHSSPPLQPALTNSVTTENRFHSLPFSLTKASSTNGAIGHSLLSSSVQSVIGDVN
TTANQESPSTGGPVGNSHGLEAGSLAEVKENPPFYGVIRWIGQPPGVNEVLAGLELEDEC
AGCTDGTFKGTRYFTCAPKKAXFVKLKSCRPDSRFASLQPVSNQIERCNSLAFGGYLSEV
VEENTPPKMEKEGLETMIGKKKGIQGHYNSCYLDSTLFCLFSFSSVLDTVLLRPKEKNDV
EYYSETQELLRTEIVNPLRIYGYVCATKIMKLRKILEKVEAASGFTSEEKDPEEFLNILF
HHILRVEPLLKIRSAGQKVQDCYFYQIFMDKNEKVGVPTIQQLLEWSFINSNLKFAEAPS
CLIIQMPRFGKDFKMFNKIFPSLELNITDLLEDTPRQCRICGGLAMYECRECYEDTDISA
GKIKQFCKTCNTQVHLHPRRQSHKFNPLSLPKDLPDWDWRHGCIPYQKMELFAVLCIETS
HYVAFVKYGRDDSAWLFFDSMADRDGGQNGFNIPQVTPCPEVGEYLKMSVEELHSLDSRK
IQGCARRLLCDAYMCMYQSPTMSLYK
NT seq 2061 nt NT seq  +upstreamnt  +downstreamnt
atggcggataatcctattggaaactgggatggaagatacaatggcatacagctgtgcagt
tttgcaagtgttgaaagtacccttcttttgcatatcaatgatgttataccagagactgtg
tcacaagacaggagacctcccaagctggcctatactgcaagaggtggtggtgataaaggt
gtgttcaaccatagtaagccaaaggcaacaggatctacctctgagcctggaaatagaaac
agatctgaagtcttctacacattaaatggatcatcagttgattctcagcctcaagcaaaa
acaaaacccccatggtatattgatgaagttgctgaagaccctgcaaaatcacttactgat
tcatctcctggatttgggcattcttcaccaccgctgcagccagctttaacaaactctgtg
actactgaaaacagattccactctctccctttcagtttgacaaaagcatcaagtactaac
ggtgctattggacacagtcttctgtcttcatctgttcagtcagtcattggtgatgtaaac
actacagctaaccaggaaagtccatcaacaggaggccctgttggtaactcgcatggtctt
gaagcaggttccttggctgaagtcaaagaaaatccccctttctatggagtaatccgctgg
attggccagccccctggagtaaatgaagtactagctggactggagctggaagacgaatgt
gcaggttgtacagatggaacgtttaaaggaactcgatacttcacttgtgctccaaagaaa
gctncttttgttaaactgaaaagctgcagaccagattccagatttgcatcactacagcca
gtttccaatcagattgaacgctgcaactctctagcctttggaggttacttaagtgaagtg
gtagaagaaaacactcctccaaaaatggaaaaagaaggtttagagacaatgattggaaag
aagaaaggtatccagggtcattacaactcctgttacttagactccaccttattctgcttg
ttttcttttagctccgttttggacactgtgttactcaggcctaaggaaaagaatgatgta
gagtattatagtgagactcaagagttactgcgaacagagattgtgaatcctcttagaata
tatggatatgtatgtgctacaaaaataatgaagctgaggaaaatacttgaaaaagttgag
gctgcatcaggattcacttcagaggaaaaagatccagaagaatttttgaatattttattt
catcatattctaagagttgaaccactgttgaaaataagatcagcgggtcagaaagtacaa
gactgttatttctaccaaatttttatggacaaaaatgagaaagttggagtcccaacaatt
cagcagttactggagtggtccttcatcaacagcaacttgaagtttgcagaggctccttct
tgcctgattattcaaatgcctcgatttggaaaagacttcaaaatgttcaacaaaattttt
ccatcgttggagctaaatataacagatttacttgaagacactcccaggcagtgccgtatt
tgcggagggctggctatgtatgagtgcagagaatgttatgaagatactgatatttctgct
gggaaaatcaagcagttctgcaaaacctgcaatacacaagttcatcttcatcccaggaga
cagagtcataaattcaatccgttgtcactccctaaagatctgccagactgggattggcga
catggctgtatcccataccagaagatggagttgtttgctgtcctctgcatagaaacaagc
cactatgtagcttttgttaagtacgggagagatgactccgcctggcttttctttgacagc
atggcagatcgggatggaggtcagaatggctttaacattccacaagtcaccccatgccca
gaagttggcgaatacctgaagatgtctgtagaagaactgcactcactggattccagaaaa
attcaaggttgtgcacgaagactgctttgtgatgcttacatgtgcatgtatcaaagtcca
acaatgagtttatacaaatga

DBGET integrated database retrieval system