KEGG   Meleagris gallopavo (turkey): 100548032Help
Entry
100548032         CDS       T01523                                 

Gene name
ARHGAP5
Definition
Rho GTPase activating protein 5
Orthology
K13709  
Rho GTPase-activating protein 5
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
Focal adhesion
Brite
KEGG Orthology (KO) [BR:mgp00001]
 Cellular Processes
  Cellular commiunity
   04510 Focal adhesion
    100548032 (ARHGAP5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
5
AA seq 1505 aa AA seqDB search
MMAKNKEPRPPSYAVSVVGLSGTEKDKGNCGVGKSCLCNRFVRSKADEYYPEHTSVLSTI
DFGGRVVNNDHFLYWGDVTQSGEDGIDCRIHVIEQTEFIDDQTFLPHRSTNLQPYIKRAA
ASKLQSAEKLMYICTDQLGLEQDFEQKQMPEGKLSIDGFLLCIDVSQGCNRKFDDQLKFV
NNLYIQLSKSKKPIIIAATKCDECVDHYLREVQAFASNKKNLVVVETSARFNVNVETCFT
ALVQMMDKTRGKPKIIPYLDAYKTQRQLVVTATDKFEKLVQTVRDYHATWKTVSNKLKNH
PDYEEYINLEGTKKAKNTFSKHIEQLKQEHIRKRKEEYINALPRALNTLLSNLDEIEHLS
WSEALKLMEKRPDFHSCFVVLEKTPWDETDHIDKVNDRRIPFDLLTTLEAEKVYQNHVQH
LISEKRRIEMKEKFKKTLEKIQFISPGQPWEEVICFVMEDEAFKYITDADSKEVYGRHQR
EIVEKAKEEFQEMLFEHSELFYDLDLNATPSSDKMSEIHAVLSEEPRYKALQKLAPDRES
LLLKHIGFVYHPTKETCLSGQNCMDIKVEQLLANSLLQLDHGRSNLYHDSANIDKVNLFI
LGKDGLAQELANEIRTQSTDDEYALDGKIYELDLRPVDAKSPYLLTQLWTSTFKPHGCFC
VFNSIESLNFIGDCIAKIRAEASQIRRDKYMASLPFTLILANQRDSVSKNLPILRHQGQQ
LANKLQCPFVDVPAGTYPRKFNETQIKQALRGVLEAVKHHFDVVSPVPTIKDLSEADLRI
VMCAMCGDPFSVDLILSPFLDSHSCSAAQAGQSNSVMLDKIIGEKRRRIQITILSYHSSI
GVRKDELVHGYILVYSAKRKASMGMLRAFLSEVQDTIPVQLVAVTDSQADFFENEAIKEL
MTEGEHIATEITAKFTALYSLSQYHRQTEVFTLFFSDVLEKKNMIESSYMSDSTRETTHT
SEDVFSRSPRGGSLDYNYPDSEDDAEGPPPYSPIGDDVRLLPTPSDRSKYRLDLEGNEYP
VHSTPLNCHDHERNHKVPPPIKPKPLVPRTNVKKLDPNLLKTIEAGIGKNPRKQPSRVPV
APPEDVDPSDNYAEPIDTIFKHKGFADDIYAVPDDSQNRIIKVRNSMPMNAQGDEENGFS
DRISKSHGERRPSKYKYKSKTLFSKAKSYYRRTHSDASDDEAFTTSKAKRKGRHRGSEED
PLLSPVETWKGGIDNPAITSDQELDDKKIKKKTQKAKEDKKQKKKVKTFNPPIRRNWESN
YFGMPLQDLVTSEKPIPLFVEKCVQFIEDTGLCTEGLYRVSGNKTDQDNIQKQFDQDHSI
SLESMEVTVNAVAGALKAFFADLPDPLIPYSLHQELLEASKILDKTERLHELKEIVKKFH
PVNYDVFKYVITHLNRVSQQYKTNFMTADNLSICFWPTLMRPDFENREFLSTTKIHQSII
ETFIQQCQFFFYNGEIVEAPNPVACQPPPSNTVQMVEPMVPLQLPPPMQPQLIQPQLPAD
PLGII
NT seq 4518 nt NT seq  +upstreamnt  +downstreamnt
atgatggcaaaaaacaaagagccacgtcccccgtcttatgctgttagtgttgttggactg
tctggaactgaaaaggataaaggtaattgtggagttgggaagtcgtgtttgtgcaataga
ttcgttcgttcaaaagcagatgaatattatcctgagcatacctctgtgcttagcacaatt
gactttggaggaagagttgttaacaatgatcactttttgtactggggtgacgtaacacaa
agtggggaggatggaattgactgcagaattcatgtaattgaacagactgagttcattgat
gatcagactttcttgcctcatcggagtacgaacttacaaccatacataaaacgtgcagct
gcctccaaactgcagtcagcagaaaaattaatgtacatttgcacagatcagctgggcttg
gagcaagactttgagcaaaaacaaatgcctgaagggaaattaagtattgatggattttta
ctgtgcattgatgtcagccaaggatgcaataggaagtttgatgatcaacttaaatttgtg
aataatctctatattcagttatcaaaatctaagaaacccataataatagcagcaacaaaa
tgtgatgaatgtgtggatcattatctacgagaggttcaagcatttgcttctaataagaag
aaccttgtggtagtggaaacatcggcaagattcaatgttaatgttgaaacttgttttact
gccctggtacaaatgatggataaaactcgtggtaaacctaaaataatcccctacttggat
gcttacaaaactcaaagacagctagttgttacagcaacagacaagtttgaaaaacttgtc
caaactgtgagagactatcatgctacttggaaaacagttagtaataaactgaaaaaccac
cctgactatgaagagtacataaatttggaaggaacaaaaaaggccaaaaatactttttca
aaacacatagagcaacttaaacaggaacatattagaaaaagaaaagaagaatacattaat
gcattgccaagagctcttaatactcttctgtcaaatctagatgagattgaacatttgagc
tggtcagaagcattgaaattaatggagaaaaggcctgacttccattcctgttttgtagtg
cttgaaaaaacaccctgggatgaaactgaccatatagataaagtgaatgacagaaggatt
ccatttgaccttctcactacactagaggcagaaaaagtttatcaaaatcatgtgcagcat
cttatatctgaaaagaggaggattgaaatgaaggagaaattcaaaaaaactcttgagaaa
atccagttcatttcacctggacagccatgggaagaagttatatgttttgttatggaggat
gaggcgttcaaatacatcactgatgcagatagtaaggaagtgtatggtaggcatcagagg
gaaattgttgaaaaagccaaagaggagtttcaggaaatgctttttgaacattcagagcta
ttttatgacctggatcttaatgcaacaccaagttcagataagatgagtgaaattcatgca
gttttgagtgaagagcctagatacaaagctttgcagaaacttgcacctgatagagaatct
cttcttctcaaacacataggattcgtttatcatccaactaaagaaacttgtctcagtggc
caaaattgcatggacattaaagtagaacagttacttgccaacagtcttctgcagttagac
catggtcgttcaaatttataccatgatagtgccaacatagataaagttaatcttttcatt
ttgggcaaagatggccttgcacaagagttagcaaatgaaattcggacgcagtccactgat
gatgaatatgcattagatggaaaaatatatgagctagatcttaggccagttgatgcgaaa
tccccatacttgttgactcagttgtggacctctaccttcaaaccacatggttgtttttgt
gtgtttaactctattgaatcgctgaattttattggggattgcattgcaaaaataagagct
gaagcatctcagataaggagagacaaatatatggccagtcttccatttacattaatactg
gctaatcagagggacagtgttagcaagaatctacctattctgagacatcagggacagcag
ttggccaacaaattacaatgtccttttgtagatgtgcctgctggtacatatccacgcaaa
tttaatgagacccaaataaaacaagctctgaggggagtactggaagcagttaaacaccac
tttgatgttgtgagtcctgttcccaccattaaagatctgtcagaagctgacctaagaatt
gtcatgtgtgctatgtgtggtgatccattcagtgtagatctcattctttcaccctttctt
gactctcactcctgtagtgctgctcaggctggccaaagcaattctgtgatgcttgataaa
attataggtgaaaagaggcgtagaatacaaataactatattatcataccattcttcaatt
ggtgtgaggaaagatgaacttgttcatggatatatactggtttactctgcaaagcggaag
gcatccatggggatgcttcgggcatttctttctgaagttcaggatacaattcctgtccaa
ttggtggctgttacagatagccaggcagacttttttgagaatgaagcaatcaaggagctc
atgactgaaggagaacatatagcaacagagattactgcaaagtttacagctttatattca
ttatctcaatatcatcgtcaaacagaggtcttcacattattcttcagtgatgtattagag
aagaaaaacatgattgaaagttcctatatgtcagacagcacaagggaaacaacgcataca
agtgaagacgttttttcaaggtctcctagaggaggttcccttgactataattatccagat
tcagaggatgatgctgagggaccacccccatacagtccaattggtgatgatgtaaggtta
cttccgacccctagtgaccgttcaaagtaccgattggacttggaaggaaatgagtatcct
gttcacagtacacctctcaattgtcacgaccatgaacgcaaccataaagtgcctcctcca
ataaaaccgaaaccccttgttccaagaacaaatgtgaaaaaactggatcctaaccttcta
aaaacaatagaggcaggtattggtaaaaacccaaggaaacaaccgtctcgagtgcctgta
gcacctccagaagatgtagacccatctgacaattatgctgaacctattgacactattttc
aaacataaaggctttgcagatgatatctacgcagttccagatgatagtcagaatcgtatt
attaaagttcgaaactcaatgcctatgaatgcccagggtgatgaagaaaatgggttttct
gacagaatatctaaaagtcatggggaaagaagaccttcaaagtacaaatataagtctaag
acattgttcagcaaagctaagtcatactataggagaacgcattcagatgcgagtgatgat
gaggcttttaccacctctaaagctaaaagaaaaggcaggcatcgtggtagtgaagaagac
ccacttctttcacctgttgaaacatggaaaggtggtatagataaccctgctattacatca
gatcaagaattggatgataaaaaaataaaaaagaaaactcagaaagcaaaagaagataag
aagcaaaaaaagaaagttaagacattcaatcctccaatccgtagaaactgggaaagtaat
tactttggaatgcccctacaagacctggttacatctgagaaacccatacctctgtttgtt
gaaaaatgtgtgcaattcattgaagatacaggattatgtactgaaggcctgtaccgtgtt
agtgggaataaaacagatcaagacaacattcagaaacagtttgatcaagatcatagtatc
agtctagagtctatggaagtgacagtaaatgctgtggctggagctcttaaagcttttttt
gcagatctgccagatccattaattccttactctttgcatcaagagttgttagaagcatca
aagatcctggataagacagaacggctacatgaattaaaagaaattgtgaagaagttccac
ccagtgaactatgatgtcttcaaatacgtgataacacatctgaacagggttagtcagcaa
tataaaaccaactttatgactgctgataacttatcaatttgtttctggcctactttgatg
agacctgattttgaaaacagagagtttctttctaccaccaaaatccaccagtcgattata
gagactttcattcagcagtgtcagtttttcttctacaatggagagattgtagaagcaccg
aacccagtggcatgtcagccaccgccttccaacacagtgcagatggtggagccaatggta
cctctgcagttaccaccaccaatgcagcctcagctgatacagccgcaattaccagcagac
cctcttggtattatataa

DBGET integrated database retrieval system