KEGG   Meleagris gallopavo (turkey): 100548057Help
Entry
100548057         CDS       T01523                                 

Gene name
POR
Definition
P450 (cytochrome) oxidoreductase
Orthology
K00327  
NADPH-ferrihemoprotein reductase [EC:1.6.2.4]
Organism
mgp  Meleagris gallopavo (turkey)
Brite
Enzymes [BR:mgp01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     100548057 (POR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
21
AA seq 676 aa AA seqDB search
MGGAGVESAVSPPESTAQDSFFSMTDVFLISLIAGLFTYWFFFRKKKEEIPDLPKIQTVS
SPARDSSFIEKMKKTGRNIVVFYGSQTGTAEEFANRLSKDAHRYGLRGMAADPEEYDLSD
LSRLSEIDKSLAVFCMATYGEGDPTDNAQDFYDWLQEADADLSGLRFAVFGLGNKTYEHF
NAMGKYVDKRLEELGAQRIFELGLGDDDGNLEEDFITWREQFWPAVCEHFGVEATGEESS
IRQYELVVHTDVNMNKVYTGEMGRLKSYENQKPPFDAKNPFLAVVTENRKLNEGGERHLM
HLELDISNSKIRYESGDHVAVYPANDASLVNQFGEILGTDLDTVMSLNNLDEESNKKHPF
PCPTSYRTALTYYLDITNPPRTNVLYELAQYATDTGEQEQLRKMASSTAEGKALYLSWVV
EARRNILAILQDMPSLHPPIDHLCELLPRLQARYYSIASSSKVHPNSIHICAVTVEYETK
TGRLNKGVATNWLKNKVPNENGRNSLVPMYVRKSQFRLPFKPSTPVIMIGPGTGIAPFIG
FIQERAWLKEQGKEVGETVLYYGCRREQEDYLYRQELARFKQEGVLTQLNVAFSRDQAEK
VYVQHLIKKNKEHIWKLVNDGNAHIYVCGDARNMARDVQNTFYEIVAEYGNMNQSQAVDY
VKKLMTKGRYSLDVWS
NT seq 2031 nt NT seq  +upstreamnt  +downstreamnt
atgggtggtgctggcgtggaatcagcagtctcccctcctgaaagcactgcacaagactct
ttcttcagcatgactgatgtgtttctcatctcactcatcgctgggctttttacttattgg
ttcttcttccgcaagaaaaaggaggaaattcctgatctccccaaaatccaaacagtatca
tccccagcaagagatagcagcttcattgagaagatgaagaagacggggcgaaacatagtg
gttttctatggttcccaaacgggtacagcagaggaatttgccaatcgcctctccaaagac
gctcaccgctatggtctccgtggcatggcagcagatccagaggagtatgacttgtcggac
ctgagtcgcctctctgagattgacaagtccttggctgtgttctgtatggccacgtatggt
gagggtgatcctacagacaatgcccaagacttctacgactggctgcaggaggctgatgct
gacctgtcaggtctccgctttgcagtctttgggctggggaacaagacttacgagcacttc
aatgccatgggaaaatatgtggacaagagattggaggagcttggagcccagcgcatcttt
gagcttggactgggagatgatgatggcaacctggaagaagacttcatcacttggagagag
cagttctggccagcagtgtgtgagcactttggggtggaggctacaggagaggaatccagc
atccgccagtatgagctggtggtgcacacagatgtgaacatgaacaaggtgtacactggg
gagatgggccgtctcaagagctacgagaaccagaagccgccatttgatgccaagaacccc
ttcctggctgtggttacagagaaccgtaagctgaatgagggtggggaacgacaccttatg
cacctggagctggatatctccaattccaaaatcaggtatgagtctggggaccacgtggct
gtttatccggccaatgacgcatctctggtgaatcagtttggtgagattctgggcacagat
ctggatacagtcatgtcactaaacaatttggatgaggaatccaacaagaaacacccattc
ccctgccccacctcctaccgtacagccctgacgtactacctggacatcaccaacccgccc
cgcaccaacgtgctctatgagctggcccagtatgccacggacactggggagcaggagcag
ctccgaaagatggcatcatccaccgctgaggggaaggctctctacctcagctgggtggtg
gaggcccggaggaacatcctggccatcctgcaggacatgccctcgctgcatccccccatc
gaccacttgtgtgagctcctgccccgtctgcaggcccgctactactccattgcctcctcc
tccaaggttcaccccaactccatccacatctgcgctgtgacggtggagtacgagaccaag
acaggacggctgaacaaaggggtggccaccaactggctgaagaacaaggtgcccaacgag
aatgggaggaactccctggtgcccatgtatgtccggaagtcgcagttccgcctgcccttc
aaacccagcacacctgtcatcatgattggaccaggcacaggcatagcccccttcattggc
ttcatacaggagcgggcctggctgaaggagcaaggcaaagaggtgggtgagacggtgctg
tactacggctgtcgccgtgagcaggaggactacctgtaccgccaggagctggcccgtttc
aagcaggagggcgtcctcacccagctcaacgtcgccttctccagggatcaggctgagaag
gtttatgtccaacacctaataaagaagaacaaggaacacatctggaagctggtgaatgat
ggaaatgctcatatctatgtgtgtggggatgcccgcaacatggcccgggacgtgcagaac
actttctatgagattgtggctgagtatggaaacatgaatcagtctcaggccgtggactat
gtaaagaaactgatgactaagggccgttactctttggatgtgtggagctaa

DBGET integrated database retrieval system