KEGG   Meleagris gallopavo (turkey): 100548062Help
Entry
100548062         CDS       T01523                                 

Definition
tyrosine-protein phosphatase non-receptor type 7-like
Orthology
K18019  
tyrosine-protein phosphatase non-receptor type 7 [EC:3.1.3.48]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
MAPK signaling pathway
Brite
KEGG Orthology (KO) [BR:mgp00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    100548062
Enzymes [BR:mgp01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     100548062
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
28
AA seq 363 aa AA seqDB search
MVQACSVCHRAHNSSLTARVATKAMDKADKPSPSAKKHVRLQERRGSNVSLVLDMSSLGS
VEPIQPVCTPRDVTLQFLRTSSHVLRTEELQQRAQSLAQLQEEFSKIPPNFISPEELEIP
GRASKDRYKTILPNPESRVCLRRAGSQEEDGYINANYITGYAGRPREYIATQGPMLNTVT
DFWEMVWQEEAPIIVMITKLQERKEKCVHYWPEKEGTYGPFTIRVQGISECAEYVVRSLS
IQLEGECRHVKHILFPSWPDQQTPESAKPLLHLVSKVEETLQAAASPGPIVVHCSAGVGR
TGCFIATRIGCQQLKDKGDVDILGIVCRLRIDRGGMIQTSEQYQFLHHTLALYASQLPEA
GGH
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atggtccaagcctgctcagtgtgccacagagctcataacagcagcctgacagcccgggtg
gccaccaaagccatggacaaggcagacaagcccagtccctctgcgaagaagcacgtgcgg
ctccaagagaggaggggctccaacgtgtcgctggtgctggacatgagctcgctgggcagc
gtggagcccatccagcccgtatgcaccccgcgggacgtcacgctgcagttcctgaggaca
tccagccacgtgctgaggacggaggagcttcagcagcgcgcccagagcctggcacagctc
caggaggagttctcgaaaatcccacccaacttcatcagtccggaggagctggagatccct
ggacgtgcctccaaggacagatacaaaaccatcctccccaatcctgagagccgggtctgc
ctcaggagggcagggagccaggaggaagacggctacatcaatgccaactacatcacgggc
tatgcaggacgtccccgggagtacattgccacccaggggcccatgctgaacaccgtgact
gatttctgggagatggtgtggcaggaggaagcacccatcatcgtcatgataaccaagctc
caggagcgcaaggagaaatgtgtccactattggcctgagaaggagggcacctacggcccc
ttcaccatccgtgtgcaggggattagcgagtgtgcggaatacgtggtccgcagtctgtcc
atccagctggaaggtgaatgccgccacgtcaaacacatcctcttcccttcctggcctgac
cagcagacacctgagtcagccaagcccctgctgcacttggtgtccaaagtggaggagact
ctgcaggctgcagccagcccagggcccatcgttgtgcactgcagtgcaggcgtcggtcgg
acgggctgcttcattgctaccaggattgggtgccagcagctgaaggacaagggagatgtg
gacatcctgggaatcgtgtgccgcctccgcatcgacagaggcgggatgatccagaccagt
gagcagtaccagtttctccatcacacactagccctgtacgcttcccagctgccagaagca
gggggccattag

DBGET integrated database retrieval system