KEGG   Meleagris gallopavo (turkey): 100548070Help
Entry
100548070         CDS       T01523                                 

Definition
(RefSeq) histone-lysine N-methyltransferase SUV39H1-like
  KO
K11419  
histone-lysine N-methyltransferase SUV39H [EC:2.1.1.43]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:mgp00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    100548070
Enzymes [BR:mgp01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     100548070
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
Un
AA seq 167 aa AA seqDB search
MVRWWCDGGGGVTVVVVLCGDVVVLHPLQIITSEEAERRGQVYDRQGATYLFDLDYVEDV
YTVDAAHYGNISHFVNHSCDPNLQVYNVFIENLDERLPRIALFATRPIRAGEELTFDYNM
HVDPVDAESTRMDSNFGLAGGGLSSSPRSRGRIECKCGAAACRKYLF
NT seq 504 nt NT seq  +upstreamnt  +downstreamnt
atggtgcggtggtggtgtgacggtggtggtggtgtgacggtggtggtggtgctgtgtggt
gatgttgtggtgctgcaccccctgcagatcatcacctcggaggaggcggagcgccgcggg
caggtgtacgaccggcagggtgccacgtacctctttgacctggactacgtggaggacgtc
tacaccgtggatgccgcccactacggcaacatctcccacttcgtcaaccacagctgcgac
cccaacctgcaggtctacaacgtcttcattgagaacctggacgagcgcctgccccgcatc
gccctcttcgccacccgccccatccgcgccggcgaggagctcaccttcgactacaacatg
cacgtggatccggtggacgcagagagcacccgcatggactccaactttggactggctggg
ggtggcctgagcagctccccccgttcccggggccgcatcgagtgcaaatgtggggccgct
gcctgccgcaagtacctcttctga

DBGET integrated database retrieval system