KEGG   Meleagris gallopavo (turkey): 100548128Help
Entry
100548128         CDS       T01523                                 

Definition
(RefSeq) 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-1-like
  KO
K05858  
phosphatidylinositol phospholipase C, beta [EC:3.1.4.11]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
Inositol phosphate metabolism
Metabolic pathways
Calcium signaling pathway
Phosphatidylinositol signaling system
Adrenergic signaling in cardiomyocytes
Vascular smooth muscle contraction
Wnt signaling pathway
Apelin signaling pathway
Gap junction
NOD-like receptor signaling pathway
GnRH signaling pathway
Melanogenesis
AGE-RAGE signaling pathway in diabetic complications
Module
Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:mgp00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100548128
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    100548128
   04371 Apelin signaling pathway
    100548128
   04020 Calcium signaling pathway
    100548128
   04070 Phosphatidylinositol signaling system
    100548128
 Cellular Processes
  Cellular community - eukaryotes
   04540 Gap junction
    100548128
 Organismal Systems
  Immune system
   04621 NOD-like receptor signaling pathway
    100548128
  Endocrine system
   04912 GnRH signaling pathway
    100548128
   04916 Melanogenesis
    100548128
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100548128
   04270 Vascular smooth muscle contraction
    100548128
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    100548128
Enzymes [BR:mgp01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     100548128
Membrane trafficking [BR:mgp04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    100548128
 Endocytosis
  Macropinocytosis
   Phospholipase C
    100548128
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Ensembl: 
Position
2
AA seq 1721 aa AA seqDB search
MAKPYEFNWQKPVPSFMQDGAVFDRYEEESFVFESNCLFQVDEFGFFLSWKSEGKEGQVL
ECSLINSVRFGAVPKDPKILTALEAVGKSENELEGRIVCVCSGIDLVNISFTFMVAENTE
VAKQWVEGLGSIIHNFRANNVSPMTCLKKHWMKLAFLTNTNGKIPVRSITRTFASGKTEK
VIFQALKELGLPSGKNDEIEPAAFTYEKFYELTQKICPRTDIEDLFKKINGDKTDYLTVD
QLVSFLNEHQRDPRLNEILFPFYDXKRAMQIIETYEPDEDLKSKGLISSDGFCRYLMSDE
NAPVFLDRLELYQEMDHPLAHYFISSSHNTYLTGRQFGGKSSVEMYRQVLLAGCRCVELD
CWDGKGEDQEPIITHGKAMCTDILFKDVIQAIKETAFVTSEYPVILSFENHCSKYQQYKM
SKYCEDLFGDLLLKQPLETHPLDPGKALPSPNDLKRKILIKNKRLKPEVEKKQLDALKKM
MEAGETAAPVNILEDDNEEEIESADQEEEAHPEYKFGSDLTVDDYSQKEAVAISVKKVGL
LLTYISLEAFHGCKTHSVLWKHHSTYCQKSPTQDLHQIPNIYYEVDIWDLLANGVSRKVV
PHDDELSQFSWRFCKLNSLEICKGKTKLQVELDQEYQDKFKRLPLEILEFVQEAMKGKIS
EDGDHSSAPSSLASDSGKSNHKPLQSEEELEEDNSEKVDHGDAPSEANSEPRPAPAENGV
NHTASLTPKPATQVVHSQPTPEVEAQTIEELKQQKSFVKLQKKHYKEMKDLVKRHHKKTT
DLIKEHTAKYNEIQNDYLRRRAVLEKTAKRDSKKRSETGSPDHGSSTIEQELAALDSEMT
QKLVELKEKQQQQLLNLRQEQYYSEKYQKREHIKLLEDAQSKRQEKLIEKHKEIRQQILD
EKPKVVLPTLACLRLAVYEEGGKFIGHRILPVSAIRPGYHYICLRNERNQPLTLPALFVY
IEVKDYVPDTYADVIEALSNPIRYVNLMEQRAKQLAALTLEDEEEVKKENGKSLIVLTIY
SFSLSPGLGSPKTFCTKLGQCEAGGHCCSLEDPKLRELLDAGNVGSRLENRMITVVYGPD
LVNISYLNLVAFQEDIAKEWSDEVFSLATNLLAQNMSRDAFLEKAYTKLKLQVTPEGRIP
LKNIYRLFSADRKRVETALEACNLPSSRNDSIPQDDFTPDVYRVFLNNLCPRPEIDHIFS
EFGAKSKPYLTVDQMMEFINLKQRDPRLNEILYPPLKQEQVQQLIEKYEPNSNLAKKGQI
SVDGFMRYLSGEENGVVPPEKLDLNEDMSQPLSHYFINSSHNTYLTAGQLAGNSSVEMYR
QVLLSGCRCVELDCWKGRTAEEEPVITHGFTMTTEISFKEVIEAIAECAFKTSPFPILLS
FENHVDSPKQQAKMAEYCRLIFGDALLMDPLEKYPLEPGVPLPSPMDLMYKILVKNKKKS
HKSADGSAKKKLSEQASNTCSDTSSMFEPSSPGAGEAEIESDDDDDYDDDCKKSSMDEGT
AGSEAMATEEMSNLVNYIQPVKFESFEVSKKRNKSFEMSSFVETKGLEQLTKSPVEFVEY
NKMQLSRIYPKGTRVDSSNYMPQVFWNAGCQMVALNFQTVDLSMQINMGMYEYNGKSGYR
LKPEFMRRPDKHFDPFTESIVDGIVANTLSVKIISGQFLSDKKVGTYVEVDMFGLPVDTR
RKALKTKTSQGNAVNPVWEEETIVFKKVGVTLASQTSVECV
NT seq 5166 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaaccttatgaatttaactggcagaagccggttccctcttttatgcaagatgga
gctgtgtttgatagatatgaagaggaatcttttgtctttgaaagcaattgtctctttcaa
gtggatgaatttggcttttttctgagctggaaaagtgaaggaaaggaaggacaggtgtta
gagtgttccctgatcaacagtgttcgttttggagctgttccaaaggatcccaaaatactg
actgcacttgaggctgttggaaaatcagaaaatgagttggaaggacggatagtgtgtgtt
tgcagtggtatagatctggtgaacatcagcttcactttcatggtagcagaaaacacagaa
gttgccaagcaatgggtagaaggactgggatccatcatacataactttagagctaacaat
gtcagtccaatgacatgtctcaagaaacactggatgaagctggcctttctaacaaataca
aatgggaaaattccagttcggagcattaccagaacctttgcatcaggtaaaacagaaaaa
gtgatctttcaagcactcaaggaattaggtcttcccagtggaaagaatgatgaaattgag
cctgcagcatttacttacgagaaattttatgagctcacccaaaagatatgtcccagaact
gacatagaggacctctttaagaagatcaatggagacaaaactgattatttaacggtagac
caattagtgagctttctaaatgaacatcaacgagatcctcggctcaatgaaattttattt
cccttttatgacnacaaaagagccatgcagataattgagacgtatgagccagatgaagac
ttgaagagtaaaggtctcatatcaagtgatggattttgcagatacttgatgtcagatgaa
aatgccccagttttcctagaccgtttggaattatatcaagaaatggaccatcctttggct
cactattttatcagttcctctcacaacacgtatttaacaggcaggcagtttggtggcaag
tcttcggtggagatgtacagacaagtgcttttggctggatgcaggtgtgttgagctggac
tgttgggacggaaaaggtgaagaccaagaaccaataataacacatggaaaagcaatgtgt
acagatattcttttcaaggatgtaattcaagccattaaggaaacagcttttgttacatca
gagtatcctgtcattctttcatttgaaaatcattgcagcaaatatcagcagtataagatg
tcaaaatactgtgaggatctttttggagatctcctgttgaagcagcctctagaaacacat
ccacttgatccaggtaaagccttaccttctcctaatgacctcaaaagaaagattctcata
aagaataaaaggttgaaacctgaagtagaaaaaaaacagctcgatgctctaaaaaagatg
atggaggctggtgaaactgctgctcctgtgaatatcttagaggatgataatgaagaagaa
atagaaagtgctgaccaggaagaagaagctcatccagaatataaatttgggagtgacctt
actgtagatgattacagtcaaaaagaagctgttgccatcagtgtcaaaaaggtgggatta
cttcttacttacatttctctggaagctttccatggatgtaaaacacattctgttttgtgg
aaacatcacagtacatattgtcagaaaagtccaacgcaagatcttcaccagattcctaat
atttactatgaagtagacatatgggatctgctggcaaatggagtctcaaggaaagttgtc
cctcacgatgatgaactatcacaatttagctggagattttgcaaactgaattctctagaa
atctgcaagggaaaaactaaattgcaggtggaacttgatcaggaatatcaagacaaattc
aaaagactgcctttggaaattctggagtttgtacaggaagccatgaaagggaaaattagt
gaagatggagaccacagttctgccccctcttctctggcatctgacagtgggaaatcaaat
cataaacctctgcaaagtgaagaggaattggaagaagataattcagaaaaagtggaccac
ggagatgcaccatctgaagctaacagtgaacctaggccagcaccagcagaaaatggagta
aatcacactgcctctcttacaccaaaaccagcaactcaggttgtccatagccaaccaaca
ccagaagtggaagcacagactattgaagagctaaaacaacaaaagtcgtttgttaagctt
cagaagaagcactacaaagaaatgaaggaccttgttaagaggcaccacaagaaaaccact
gatcttatcaaagagcacactgcaaagtataatgaaatccaaaatgactatctgcgacga
agagcagttttagaaaaaacagcaaaaagagacagtaagaaaagatctgaaacgggcagc
ccagaccatggttcatcaactatcgaacaagaattggctgcccttgactctgaaatgacc
cagaagctagtcgagctgaaggaaaagcaacagcagcagctgctaaacctccgacaggag
cagtattacagtgaaaagtaccagaagcgagagcacattaagctgctagaggatgctcag
agtaaaagacaggagaaactgatagaaaaacacaaggagattcgtcagcaaatactggat
gaaaagcccaaggttgttttacctaccctggcatgtttgaggctagcagtgtatgaggaa
ggagggaaatttattggccatcggatattaccagtttcagcaattcgaccaggctaccac
tacatctgtttgaggaatgagaggaaccaacctttgacactgccagctctctttgtgtac
atagaggtcaaagactatgtgcctgatacttacgcagatgtgatcgaggccttatccaat
ccaatcagatatgtaaacttgatggagcagagagctaagcagttggcagcactgactctg
gaagatgaagaagaggtaaagaaagagaatggaaagagtctcattgtattgactatttac
tctttcagccttagtcctggcctcggaagcccaaagactttctgtactaaacttggccag
tgtgaagcaggaggacattgctgctccctggaggatccaaagctgcgtgaactgttggat
gctgggaatgttggaagtcgactggaaaatcgaatgataactgttgtctatggaccagac
ctggtcaatatatcgtacttgaacttggtggcatttcaagaggatatagcaaaggaatgg
tcagatgaagtgttcagtttggcaacaaatttgttggcacagaacatgtcaagggacgca
tttctggaaaaagcatacacaaaacttaaactacaggtgactccagaaggacgcattcct
ctgaagaacatataccgcttgttttctgctgacagaaaacgtgtagagacagcattagaa
gcctgtaatcttccatcttccaggaatgattcaatccctcaagatgacttcacacctgac
gtgtacagagtgttcttaaacaacctctgccctcgacctgaaatcgaccacatcttttcc
gagtttggtgccaagagtaaaccataccttactgttgatcagatgatggaatttataaat
cttaagcaacgtgatccacgattaaatgaaatcctttatccaccattaaaacaggagcaa
gttcaacaactgattgagaaatatgaacccaacagtaacctagcgaagaaaggacagata
tcagtggatggatttatgcggtatctgagtggagaagaaaatggcgttgttccacctgag
aaactggatttaaatgaagatatgtctcaaccactgtcacactatttcatcaattcctca
cacaacacctacctcacagctggacagctggctgggaactcttcagtggagatgtatcgg
caagtgcttctgtcaggctgccgctgtgtggagctggactgctggaaagggagaacagct
gaagaagagccggtcattacgcacgggttcactatgacaactgaaatatctttcaaggaa
gtaatagaagctattgctgagtgtgcatttaagacatcgccctttccaatcctcctttcc
tttgaaaatcatgtggattcccctaaacaacaggcaaaaatggcagagtactgcagatta
atatttggagatgcattgcttatggatccattggagaaatacccgcttgaacctggggtt
cctcttccaagccctatggatttaatgtacaaaattctggtaaaaaataaaaagaaatca
cataagtctgcagatggaagtgccaagaagaagctctcagagcaagcctccaacacgtgt
agtgatacatctagtatgttcgagccttcctccccaggagcaggagaagcagagattgag
agcgatgatgatgatgactacgatgatgattgcaaaaagtcgtcaatggatgaaggtacc
gctggaagtgaggctatggccacggaagagatgtctaacctggtgaactacattcagcct
gtgaaatttgaatcatttgaggtatcaaaaaaacgcaacaaaagttttgaaatgtcttcc
ttcgtggaaaccaaagggcttgagcaacttaccaagtctccggtggaatttgtggaatac
aacaaaatgcagctaagccgaatttacccaaaaggaacacgtgtagattcttcaaactac
atgccacaagtcttttggaatgctggctgccaaatggttgctctcaacttccaaacagta
gatttgtctatgcaaataaacatgggaatgtatgagtacaatggcaaaagtggatacagg
ttaaagccagaattcatgagaagaccagacaaacactttgatccatttactgaaagtatt
gtggatggaatcgtagctaacaccttgtctgtgaagattatttcaggtcagtttctttcc
gataaaaaagttggtacctatgtagaagttgacatgtttggcctgcctgtggatacaaga
agaaaagctttaaagaccaagacctcgcaaggcaatgcagttaatcctgtctgggaagag
gaaactatagtgtttaaaaaggttggtgtaacacttgcttctcaaaccagcgttgagtgt
gtttaa

DBGET integrated database retrieval system