KEGG   Meleagris gallopavo (turkey): 100548217Help
Entry
100548217         CDS       T01523                                 

Gene name
G6PC
Definition
(RefSeq) glucose-6-phosphatase catalytic subunit
  KO
K01084  
glucose-6-phosphatase [EC:3.1.3.9]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Metabolic pathways
FoxO signaling pathway
Insulin signaling pathway
Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:mgp00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100548217 (G6PC)
   00052 Galactose metabolism
    100548217 (G6PC)
   00500 Starch and sucrose metabolism
    100548217 (G6PC)
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    100548217 (G6PC)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    100548217 (G6PC)
   04920 Adipocytokine signaling pathway
    100548217 (G6PC)
Enzymes [BR:mgp01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.9  glucose-6-phosphatase
     100548217 (G6PC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
Position
29
AA seq 220 aa AA seqDB search
MGKKQSRTLKYWILWIMLWTGFWAIQVCVCLSRVFIAAHFPHQVIAGVISGMAVAETFQH
IHSIYHASLHRYLGITFFLFSFALGFYLLLRVLGVELLWTLEKAQKWCAHPEWVHIDTTP
FASLLRNLGILFGLGLALSSHMYLESCRGKQGHQLSFRLGCAAASLLVLHLFDAFRLPSH
MQLLFYVLSFCKSAAVPLATVGLIPYCISQFLATQDKKGV
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atgggcaagaagcagtcaagaacactgaagtactggattctgtggatcatgctgtggacg
gggttctgggccattcaggtctgtgtctgtctgtcccgcgttttcatcgctgcccacttt
ccacatcaggtcatcgcaggggtcatatctggcatggctgtggctgagaccttccagcac
atccattccatctaccatgccagcctccacaggtacctgggcatcaccttcttcctcttc
agcttcgccttgggcttctacctgctactgcgtgtccttggtgttgaactgctctggaca
ctggagaaggcacagaagtggtgcgcccatcctgagtgggtccacatcgataccacgccc
ttcgccagccttcttcgcaacctgggcatcctctttgggctggggctggctctgagttcc
cacatgtacctggagagctgccgtgggaagcaaggccaccagctgtccttccgcctaggc
tgtgctgccgcctcgctgctggtcctgcacctctttgatgccttcaggctgccctcccac
atgcagctgctcttctatgtcctttccttctgcaagagcgcagctgtgccgctggccact
gtcggcctcatcccctactgcatctctcagtttctggccacgcaggacaagaagggtgtc
tag

DBGET integrated database retrieval system