KEGG   Meleagris gallopavo (turkey): 100548314Help
Entry
100548314         CDS       T01523                                 

Gene name
COMP
Definition
(RefSeq) cartilage oligomeric matrix protein
  KO
K04659  
thrombospondin 2/3/4/5
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
Phagosome
Focal adhesion
ECM-receptor interaction
Brite
KEGG Orthology (KO) [BR:mgp00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    100548314 (COMP)
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    100548314 (COMP)
  Cellular commiunity
   04510 Focal adhesion
    100548314 (COMP)
Exosome [BR:mgp04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100548314 (COMP)
  Exosomal proteins of colorectal cancer cells
   100548314 (COMP)
  Exosomal proteins of bladder cancer cells
   100548314 (COMP)
Glycosaminoglycan binding proteins [BR:mgp00536]
 Heparan sulfate/Haparin
  Extracellular matrix molecules (General comment) Storage depot, cell adhesion and motility, ECM/barrier formation
   100548314 (COMP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
30
AA seq 761 aa AA seqDB search
MISALAFXFLLCLSCPFSSCQQRRAGIEVGPEMLEEMRETNRVLMEVRDLLKQQIKEITF
LKNTVMECDACGIHTEATGPVITVTQFNRCVPNPCFPGVACTETSTGFRCGPCPPGYSGN
GSQCTDINECSANPCFPKVQCINTAPGFRCDPCPPGFTGQMVEGVGLAYARANKQVCTDI
NECETGAARNCVPNSICINTRGSYKCGACKPGFVGDQITGCKSQTGRLCPNGEVSPCHEK
AQCIVERDGSISCACLVGWAGNGYICGKDTDIDGVPDEKLRCSDKKCRKDNCMTVPNSGQ
EDADRDGIGDACDDDADGDGILNAEDNCVYTRNADQRNADKDNFGDACDNCRQVKNDDQR
DIDGDGKGDECDDDIDGDGIRNPTDNCVRVPNPDQKDSDGDGVGDICDSCPTVSNPDQKD
TDHDLVGDVCDTNQDSDGDGHQDTRDNCPSVPNSSQVDTDNDGLGDECDDDDDNDGIPDE
KPPGPDNCRLVPNPGQEDSDGDGVGNLCEDDFDRDMVIDRIDVCPENAEVTLTDFRAFQT
VVLDPEGDAQIDPNWIVLNQGMEIVQTMNSDPGLAVGYTAFNGVDFEGTFHVNTATDDDY
AGFIFGYQDSSSFYVVMWKQMEQTYWQANPFRAVAEPGIQLKAVKSKTGPGEYLRNSLWH
TGDTTDQVKLLWKDPRNSGWKDKTSYRWFLQHRPQVGYIRARFYEGPEVVADTGVVLDTT
MRGGRLGVFCFSQENIIWSNLRYRCNDTIPEDYETFKVQQD
NT seq 2286 nt NT seq  +upstreamnt  +downstreamnt
atgatttcagctctagcctttngttttctcctctgcctctcttgtcctttttcatcatgt
cagcagagaagagcaggaattgaagttgggcctgaaatgctggaagagatgagagaaacg
aaccgtgtgttaatggaagttcgagacttgttgaaacagcagattaaggagataacattc
ctgaagaacacagtcatggagtgtgatgcctgtggcatacacactgaagcaacaggcccc
gtcatcactgtgacacagtttaacagatgtgtcccaaacccctgcttccctggagtggcc
tgcactgagaccagcactggcttccgctgcggaccctgtcccccaggctattcagggaat
gggtcccagtgcacagatatcaatgagtgcagtgcaaacccctgcttcccaaaggtccag
tgcattaacactgctcctggcttccgctgcgatccgtgccctcctggcttcactgggcaa
atggtcgaaggagttggcctagcttatgccagggccaacaaacaggtttgcactgacatc
aatgaatgtgagacaggtgctgccagaaattgtgtcccaaattctatctgtatcaacaca
cggggatcctacaagtgtggagcttgtaaacctggctttgttggggatcaaatcactggc
tgcaagagccagacagggagactctgccctaacggtgaagtcagcccatgccacgagaaa
gcacagtgcatcgtggagcgggatgggtccatctcgtgtgcgtgccttgtggggtgggca
gggaatggctacatctgtgggaaggatacagacattgatggagtccctgatgaaaagctg
cgctgctctgacaagaagtgccgcaaggataactgcatgactgtccccaactctggccag
gaggatgcagacagggatggaattggagatgcctgtgatgatgatgctgatggagatggg
atattaaatgccgaggacaactgtgtgtacacacgcaatgcagaccagcgcaatgcagac
aaggataactttggtgatgcctgtgacaactgtcgccaagtgaagaacgatgaccagcgg
gacattgatggtgatgggaaaggagatgagtgtgacgatgacatagatggagatggaatc
cgaaatccaacggacaactgtgtaagagttcctaaccctgatcaaaaagacagtgatggt
gatggagtaggagatatctgcgacagctgcccaacagtcagtaacccagaccagaaagat
actgatcatgatctcgtgggagatgtctgtgacaccaaccaggacagtgatggcgatggc
caccaagatacaagagataactgcccatcagtgcctaacagctcccaggtggacacagac
aatgatggactaggagatgaatgtgatgatgatgatgacaatgatgggattccagatgag
aaacctccaggccctgacaactgtcggcttgtccctaaccctggccaagaagattcggat
ggtgacggtgtaggaaatctttgtgaagatgactttgacagagacatggtgattgacaga
attgatgtgtgcccagagaacgcagaagtgacactaacagacttcagggctttccagacg
gttgtgttggaccctgagggtgatgcacagattgaccccaactggattgtccttaaccag
ggcatggaaattgtccaaaccatgaacagcgatcctggcttggctgtaggttacacagca
ttcaatggagtggactttgagggcacgttccatgtcaacactgccacagatgatgattat
gctggcttcatatttggctaccaggacagttccagcttttatgtggtcatgtggaagcag
atggagcagacatactggcaggcaaaccccttccgagcagtcgcagaacctggtattcaa
ctgaaggcagtgaagtccaaaacaggcccaggtgagtacctgcgcaattctctctggcac
actggggacaccacagaccaagtcaagctgctgtggaaggaccctcgcaactctggctgg
aaggacaagacgtcgtaccgctggttcctgcagcatcggcctcaggttggatacatcaga
gctcgcttctatgaaggcccagaggttgtagcagacactggagttgtccttgatacaact
atgcgaggagggcgcctgggagtcttctgcttctcccaagagaacatcatttggtcaaac
ctgcgttaccgctgcaatgatactattccagaagactatgaaacatttaaagttcagcaa
gactag

DBGET integrated database retrieval system