KEGG   Meleagris gallopavo (turkey): 100548314Help
Entry
100548314         CDS       T01523                                 

Definition
cartilage oligomeric matrix protein-like
Orthology
K04659  
thrombospondin 2/3/4/5
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
Phagosome
Focal adhesion
ECM-receptor interaction
Brite
KEGG Orthology (KO) [BR:mgp00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    100548314
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    100548314
  Cellular commiunity
   04510 Focal adhesion
    100548314
Exosome [BR:mgp04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100548314
  Exosomal proteins of colorectal cancer cells
   100548314
  Exosomal proteins of bladder cancer cells
   100548314
Heparan sulfate/heparin binding proteins [BR:mgp00536]
 Extracellular matrix molecules (General comment) Storage depot, cell adhesion and motility, ECM/barrier formation
  100548314
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
30
AA seq 761 aa AA seqDB search
MISALAFVFLLCLSCPFSSCQQRRAGIEVGPEMLEEMRETNRVLMEVRDLLKQQIKEITF
LKNTVMECDACGIHTEATGPVITVTQFNRCVPNPCFPGVACTETSTGFRCGPCPPGYSGN
GSQCTDINECSANPCFPKVQCINTAPGFRCDPCPPGFTGQMVEGVGLAYARANKQVCTDI
NECETGAARNCVPNSICINTRGSYKCGACKPGFVGDQITGCKSQTGRLCPNGEVSPCHEK
AQCIVERDGSISCACLVGWAGNGYICGKDTDIDGVPDEKLRCSDKKCRKDNCMTVPNSGQ
EDADRDGIGDACDDDADGDGILNAEDNCVYTRNADQRNADKDNFGDACDNCRQVKNDDQR
DIDGDGKGDECDDDIDGDGIRNPTDNCVRVPNPDQKDSDGDGVGDICDSCPTVSNPDQKD
TDHDLVGDVCDTNQDSDGDGHQDTRDNCPSVPNSSQVDTDNDGLGDECDDDDDNDGIPDE
KPPGPDNCRLVPNPGQEDSDGDGVGNLCEDDFDRDMVIDRIDVCPENAEVTLTDFRAFQT
VVLDPEGDAQIDPNWIVLNQGMEIVQTMNSDPGLAVGYTAFNGVDFEGTFHVNTATDDDY
AGFIFGYQDSSSFYVVMWKQMEQTYWQANPFRAVAEPGIQLKAVKSKTGPGEYLRNSLWH
TGDTTDQVKLLWKDPRNSGWKDKTSYRWFLQHRPQVGYIRARFYEGPEVVADTGVVLDTT
MRGGRLGVFCFSQENIIWSNLRYRCNDTIPEDYETFKVQQD
NT seq 2286 nt NT seq  +upstreamnt  +downstreamnt
atgatttcagctctagcctttgtttttctcctctgcctctcttgtcctttttcatcatgt
cagcagagaagagcaggaattgaagttgggcctgaaatgctggaagagatgagagaaacg
aaccgtgtgttaatggaagttcgagacttgttgaaacagcagattaaggagataacattc
ctgaagaacacagtcatggagtgtgatgcctgtggcatacacactgaagcaacaggcccc
gtcatcactgtgacacagtttaacagatgtgtcccaaacccctgcttccctggagtggcc
tgcactgagaccagcactggcttccgctgcggaccctgtcccccaggctattcagggaat
gggtcccagtgcacagatatcaatgagtgcagtgcaaacccctgcttcccaaaggtccag
tgcattaacactgctcctggcttccgctgcgatccgtgccctcctggcttcactgggcaa
atggtcgaaggagttggcctagcttatgccagggccaacaaacaggtttgcactgacatc
aatgaatgtgagacaggtgctgccagaaattgtgtcccaaattctatctgtatcaacaca
cggggatcctacaagtgtggagcttgtaaacctggctttgttggggatcaaatcactggc
tgcaagagccagacagggagactctgccctaacggtgaagtcagcccatgccacgagaaa
gcacagtgcatcgtggagcgggatgggtccatctcgtgtgcgtgccttgtggggtgggca
gggaatggctacatctgtgggaaggatacagacattgatggagtccctgatgaaaagctg
cgctgctctgacaagaagtgccgcaaggataactgcatgactgtccccaactctggccag
gaggatgcagacagggatggaattggagatgcctgtgatgatgatgctgatggagatggg
atattaaatgccgaggacaactgtgtgtacacacgcaatgcagaccagcgcaatgcagac
aaggataactttggtgatgcctgtgacaactgtcgccaagtgaagaacgatgaccagcgg
gacattgatggtgatgggaaaggagatgagtgtgacgatgacatagatggagatggaatc
cgaaatccaacggacaactgtgtaagagttcctaaccctgatcaaaaagacagtgatggt
gatggagtaggagatatctgcgacagctgcccaacagtcagtaacccagaccagaaagat
actgatcatgatctcgtgggagatgtctgtgacaccaaccaggacagtgatggcgatggc
caccaagatacaagagataactgcccatcagtgcctaacagctcccaggtggacacagac
aatgatggactaggagatgaatgtgatgatgatgatgacaatgatgggattccagatgag
aaacctccaggccctgacaactgtcggcttgtccctaaccctggccaagaagattcggat
ggtgacggtgtaggaaatctttgtgaagatgactttgacagagacatggtgattgacaga
attgatgtgtgcccagagaacgcagaagtgacactaacagacttcagggctttccagacg
gttgtgttggaccctgagggtgatgcacagattgaccccaactggattgtccttaaccag
ggcatggaaattgtccaaaccatgaacagcgatcctggcttggctgtaggttacacagca
ttcaatggagtggactttgagggcacgttccatgtcaacactgccacagatgatgattat
gctggcttcatatttggctaccaggacagttccagcttttatgtggtcatgtggaagcag
atggagcagacatactggcaggcaaaccccttccgagcagtcgcagaacctggtattcaa
ctgaaggcagtgaagtccaaaacaggcccaggtgagtacctgcgcaattctctctggcac
actggggacaccacagaccaagtcaagctgctgtggaaggaccctcgcaactctggctgg
aaggacaagacgtcgtaccgctggttcctgcagcatcggcctcaggttggatacatcaga
gctcgcttctatgaaggcccagaggttgtagcagacactggagttgtccttgatacaact
atgcgaggagggcgcctgggagtcttctgcttctcccaagagaacatcatttggtcaaac
ctgcgttaccgctgcaatgatactattccagaagactatgaaacatttaaagttcagcaa
gactag

DBGET integrated database retrieval system