KEGG   Meleagris gallopavo (turkey): 100548322Help
Entry
100548322         CDS       T01523                                 

Definition
cytochrome P450 2D3-like
Orthology
K07414  
cytochrome P450, family 2, subfamily D [EC:1.14.14.1]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
Steroid hormone biosynthesis
Class
Metabolism; Lipid metabolism; Steroid hormone biosynthesis [PATH:mgp00140]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
1
AA seq 502 aa AA seqDB search
MTLLLWLSSWSNISVLGVFLTVFTVLVDFMKRRKKWSCYPPGPVSLPFVGTMPYVNYNNP
ILSFEKFRKKFGNVFSLQNCWTNVVVLNGYNTVKEALVNKSEDFADRPYMPIYEHLGYGH
KSEGIVLAKYGHVWKELRKFTLITLRNFGMGKKSLEERVTEEAGFLCSAISSEGGRPFDL
HLLVNNAVSNVICTITYGERFEYGDETFKKLLTLFENSLNEEIGLLPELLQVVPILLRIP
GLPQMIFRCQKEYIDFTEMLIEKHKETWNPAYTRDFTDAFLKEMAKGNEAEVNGFNRTNL
SFVTSDLLAAGSQTTSTTLRWAFLFMLLYPEIQSKVHKEIDKVIGRNRPPTMADQANMPY
TNAVIHEVQRCGDIIPMGLPHMTYRDTKLQGFFIPKGTTIITNLTSVLKDETVWKKPNEF
YPEHFLNENGEFVRPEAFLPFSAGRRACLGEQLAKMELFIFFTTLMQKFTFVIPEDQPRP
REDGHFAFINSPHPYQLQAVPR
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgacactgctcctgtggctgtcatcttggagcaacatctctgtactgggagtttttctt
accgtctttactgtgcttgttgatttcatgaagcgcagaaagaagtggagctgttacccc
ccaggcccagtgtcattgccgtttgtggggaccatgccatacgttaactacaacaacccg
attctctccttcgagaagtttcgcaagaagtttggaaacgtcttcagtctccagaactgc
tggaccaacgtggtagtgctgaatgggtacaacactgtgaaggaagccttggtcaacaaa
tcggaggactttgctgaccggccatacatgccaatatatgaacatctgggctatggacat
aaatctgaaggtattgttttggcaaaatatggacatgtttggaaggagctaaggaaattc
acgctcattaccctaaggaactttgggatgggaaagaagtccttggaggagcgagtgact
gaggaagcaggatttctgtgctctgcaatcagttctgaaggaggtcgtccttttgatctg
catcttcttgtaaataatgcggtcagcaatgtgatctgcaccatcacctatggagagcgt
ttcgagtacggtgacgagacattcaagaagctgttaactttgtttgaaaactccctgaat
gaagaaattggactcctgcctgagcttcttcaagtggtgcccattttgttgcgcattcct
ggactgccacagatgatctttcgatgccaaaaggaatacatagacttcacagaaatgctc
atagagaagcacaaggagacctggaaccctgcttacacccgagacttcactgatgcattt
ttaaaggaaatggcaaagggtaatgaggctgaagtgaatggtttcaatagaaccaacctt
agcttcgtgacgtcagacttgcttgcagcaggttctcaaaccacctccaccactctccga
tgggcgttcctgttcatgcttttgtacccagaaatacagagtaaagtccacaaagagatt
gataaggtgattggaagaaaccgaccgcccaccatggcagaccaagcaaacatgccctac
accaatgccgtcatccatgaagtacaacgctgtggggacattattcctatggggctacct
cacatgacataccgggacaccaagcttcaaggtttcttcattcccaaggggacgacaatc
atcaccaacttgacttctgtgctgaaggatgagacagtctggaagaagccaaatgagttt
tatcccgaacacttcctgaatgaaaatggggaatttgtgagaccagaggccttcttgccc
ttctctgcaggtcgacgtgcctgcctgggggaacagctggccaagatggagctcttcatc
ttcttcaccactctcatgcagaagttcacctttgtgatccctgaagatcagcccaggcca
cgggaggacggtcactttgcttttataaacagcccacacccataccagctgcaagctgtt
ccaagataa

DBGET integrated database retrieval system