KEGG   Meleagris gallopavo (turkey): 100548322Help
Entry
100548322         CDS       T01523                                 

Definition
cytochrome P450 2D3-like
Orthology
K07414  
cytochrome P450, family 2, subfamily D [EC:1.14.14.1]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
Steroid hormone biosynthesis
Brite
KEGG Orthology (KO) [BR:mgp00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    100548322
Enzymes [BR:mgp01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     100548322
Cytochrome P450 [BR:mgp00199]
 Cytochrome P450, animal type
  CYP2 family
   100548322
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
1
AA seq 502 aa AA seqDB search
MTLLLWLSSWSNISVLGVFLTVFTVLVDFMKRRKKWSCYPPGPVSLPFVGTMPYVNYNNP
ILSFEKFRKKFGNVFSLQNCWTNVVVLNGYNTVKEALVNKSEDFADRPYMPIYEHLGYGH
KSEGIVLAKYGHVWKELRKFTLITLRNFGMGKKSLEERVTEEAGFLCSAISSEGGRPFDL
HLLVNNAVSNVICTITYGERFEYGDETFKKLLTLFENSLNEEIGLLPELLQVVPILLRIP
GLPQMIFRCQKEYIDFTEMLIEKHKETWNPAYTRDFTDAFLKEMAKGNEAEVNGFNRTNL
SFVTSDLLAAGSQTTSTTLRWAFLFMLLYPEIQSKVHKEIDKVIGRNRPPTMADQANMPY
TNAVIHEVQRCGDIIPMGLPHMTYRDTKLQGFFIPKGTTIITNLTSVLKDETVWKKPNEF
YPEHFLNENGEFVRPEAFLPFSAGRRACLGEQLAKMELFIFFTTLMQKFTFVIPEDQPRP
REDGHFAFINSPHPYQLQAVPR
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgacactgctcctgtggctgtcatcttggagcaacatctctgtactgggagtttttctt
accgtctttactgtgcttgttgatttcatgaagcgcagaaagaagtggagctgttacccc
ccaggcccagtgtcattgccgtttgtggggaccatgccatacgttaactacaacaacccg
attctctccttcgagaagtttcgcaagaagtttggaaacgtcttcagtctccagaactgc
tggaccaacgtggtagtgctgaatgggtacaacactgtgaaggaagccttggtcaacaaa
tcggaggactttgctgaccggccatacatgccaatatatgaacatctgggctatggacat
aaatctgaaggtattgttttggcaaaatatggacatgtttggaaggagctaaggaaattc
acgctcattaccctaaggaactttgggatgggaaagaagtccttggaggagcgagtgact
gaggaagcaggatttctgtgctctgcaatcagttctgaaggaggtcgtccttttgatctg
catcttcttgtaaataatgcggtcagcaatgtgatctgcaccatcacctatggagagcgt
ttcgagtacggtgacgagacattcaagaagctgttaactttgtttgaaaactccctgaat
gaagaaattggactcctgcctgagcttcttcaagtggtgcccattttgttgcgcattcct
ggactgccacagatgatctttcgatgccaaaaggaatacatagacttcacagaaatgctc
atagagaagcacaaggagacctggaaccctgcttacacccgagacttcactgatgcattt
ttaaaggaaatggcaaagggtaatgaggctgaagtgaatggtttcaatagaaccaacctt
agcttcgtgacgtcagacttgcttgcagcaggttctcaaaccacctccaccactctccga
tgggcgttcctgttcatgcttttgtacccagaaatacagagtaaagtccacaaagagatt
gataaggtgattggaagaaaccgaccgcccaccatggcagaccaagcaaacatgccctac
accaatgccgtcatccatgaagtacaacgctgtggggacattattcctatggggctacct
cacatgacataccgggacaccaagcttcaaggtttcttcattcccaaggggacgacaatc
atcaccaacttgacttctgtgctgaaggatgagacagtctggaagaagccaaatgagttt
tatcccgaacacttcctgaatgaaaatggggaatttgtgagaccagaggccttcttgccc
ttctctgcaggtcgacgtgcctgcctgggggaacagctggccaagatggagctcttcatc
ttcttcaccactctcatgcagaagttcacctttgtgatccctgaagatcagcccaggcca
cgggaggacggtcactttgcttttataaacagcccacacccataccagctgcaagctgtt
ccaagataa

DBGET integrated database retrieval system