KEGG   Meleagris gallopavo (turkey): 100548345Help
Entry
100548345         CDS       T01523                                 

Gene name
ITGB6
Definition
integrin, beta 6
Orthology
K06589  
integrin beta 6
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
Focal adhesion
ECM-receptor interaction
Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:mgp00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    100548345 (ITGB6)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    100548345 (ITGB6)
  Cellular commiunity
   04510 Focal adhesion
    100548345 (ITGB6)
Exosome [BR:mgp04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   100548345 (ITGB6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
7
AA seq 591 aa AA seqDB search
MDLSASMDDDLNTIKELGSTLSKEMSKLTSNFRLGFGSFVEKPVSPFIKTTAEEISNPCR
SVPYECLPTFGYKHVLSLTNDAERFNEIVKGQRISANIDTPEGGFDAIMQAAVCKEKIGW
RNDSLHLLVFVSDADSHFGMDSKLAGIVIPNDGNCHLDHNNEYSMSTILEYPTIGQLIDK
LVQNNVLVIFAVTNEQVHTYENYAKLIPGATVGRLQKDSGNILQLIIAAYQELRSEVELE
VFGDTEGLNLSFTAICNNGTFFPHQRKCSHVKVGDTVSFNVTINLPTCDKTTRHVVIKPV
GLSDMLEMEILPQCSCSCQAKAERNSSKCNKGKGTFECGVCVCHPGYMGPHCECDENALS
TGSCKGSVEQSSCSGRGSCYCGQCVCHPSMYGRVYGAHCECDDFSCVRHRGLQCGGNGDC
DCGECVCHSGWTGEYCNCTTDTSSCISEDGMLCSGRGECICGSCVCIHPGASGQTCEKCP
LCGDPCSSRRSCVECHLASDDKLQGECSEKCKSVDATVSTAEDFSEDKSIPCSLQGENEC
ITTFLLTVDEQGKTVIHSIKQKGKQFCYLFYVTSNLKTQMGATISSSNTRN
NT seq 1776 nt NT seq  +upstreamnt  +downstreamnt
atggatctttcagcttccatggatgatgacctgaatacaataaaagaattaggctcaact
ctttccaaagaaatgtcgaaactgacaagcaacttcagactgggttttggatcttttgtt
gaaaaaccagtttcaccatttatcaaaactacagctgaagaaataagcaatccttgcaga
agtgtgccttatgagtgcttgcccacctttggatacaagcatgttttgtcactgacaaat
gatgctgaaagattcaatgaaattgtaaaaggacagcgaatctctgctaacatagatact
ccagagggaggatttgatgcaattatgcaggcagctgtttgcaaggaaaaaattggatgg
aggaatgactctctgcatttactggtgtttgtgagtgatgccgattcccactttgggatg
gacagcaagctagcaggaattgttattcctaatgatgggaactgtcatttggaccacaat
aatgaatattccatgtcaactattctggagtatcccacaattggacaattaattgacaaa
cttgtgcaaaacaatgttttggtaatttttgctgtcacgaatgaacaagttcacacatac
gagaactatgcaaagcttattcctggagctactgttggtcgactgcagaaggattctgga
aatattctccagctgatcattgctgcatatcaggagctgaggtccgaagtagagctggag
gtctttggggacacagaaggactcaatctctctttcactgccatctgtaacaatgggacc
ttttttccacatcagaggaaatgctctcacgtgaaagtgggagacacagtctctttcaat
gtgaccataaatctgcccacttgtgataaaaccaccaggcacgttgtgataaaaccagtg
ggtctcagtgacatgctggaaatggaaattcttccccagtgcagctgcagctgccaggcc
aaggctgagaggaacagctctaagtgcaacaaggggaaaggcacttttgagtgcggagtg
tgtgtctgccaccccgggtacatgggtccacactgcgagtgtgatgagaatgccctcagc
actggatcctgcaagggctccgtggagcagagctcctgcagcgggagaggcagctgctat
tgtgggcagtgcgtttgccacccatccatgtatggaagagtttatggggcgcactgtgag
tgtgatgacttctcgtgtgtgagacacagaggacttcagtgtggaggcaatggagactgt
gactgtggcgaatgcgtgtgccacagtggatggactggtgaatactgtaattgcacaact
gacaccagctcctgcatttctgaggatggaatgctgtgcagtgggagaggtgaatgcatc
tgcgggtcgtgtgtgtgcatacatccaggggcttcaggccaaacgtgtgaaaaatgcccg
ctgtgtggtgacccttgcagttccagaaggagctgtgtggaatgtcatttggcttctgat
gacaagctgcagggagaatgcagtgaaaaatgcaaatcagttgacgcaactgtcagcact
gcagaggatttttcagaggataaatccattccttgctctttacagggggagaacgaatgt
ataaccacttttcttctgactgtagatgaacagggcaagacagtcattcacagcataaag
caaaaaggtaagcagttttgttaccttttctacgtgacatctaatttgaaaacacagatg
ggagcgacaatcagttccagcaacacaagaaactga

DBGET integrated database retrieval system