KEGG   Meleagris gallopavo (turkey): 100548368Help
Entry
100548368         CDS       T01523                                 

Gene name
DYRK3
Definition
dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 3
Orthology
K18669  
dual specificity tyrosine-phosphorylation-regulated kinase 2/3/4 [EC:2.7.12.1]
Organism
mgp  Meleagris gallopavo (turkey)
Brite
Enzymes [BR:mgp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     100548368 (DYRK3)
Protein kinases [BR:mgp01001]
 Serine/threonine protein kinases: CMGC group
  DYRK family [OT]
   100548368 (DYRK3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
28
AA seq 551 aa AA seqDB search
MRIDQLRYQESANEEHSPSGLPSLGRSNVCSNKLAMKDHPLSGSQVKVEQLFEDSGNRRS
STLQSAGITCSERSLPSLTKDKSIESLSTSKGGSSSSKAHKAVSQAPEQAVKQYKHQLSA
YEQQEIFNFSEIYFVGPAAKKRQGVIGGPNNGGYDDDQGSYIHVPHDHLAYRYEVLKIIG
KGSFGQVAKVYDHKLHQHLALKMVRNEKRFHRQAAEEIRILEHLKKQDKTGSMNVIHMLE
SFTFRNHICMTFELLSMNLYELIKRNKFQGFSIQLVRKFAHSILQCLDALYRNKIIHCDL
KPENILLKQQGRSGIKVIDFGSSCFEHQRVYTYIQSRFYRAPEVILGSRYGMPIDMWSFG
CILVELLTGYPLFPGEDEGDQLACMMELLGMPPQKLLDQSKRAKNFINSKGHPRYCTVTT
HADGRVTLNGSRSRRGKVRGAPGNKDWVTALKGCDDPLFIEFLKECLSWDPAVRMTPSQA
LRHPWICKRTPKPPSTDKTSSKRISSYTSSFTGIGSKLPPVVGVANKLRANLTSDANGSI
PLCTVLPKLVS
NT seq 1656 nt NT seq  +upstreamnt  +downstreamnt
atgaggatagatcagcttaggtaccaagagtctgcaaatgaagagcacagcccctcagga
ctgccttcccttgggagatctaacgtttgtagcaacaaacttgcaatgaaggatcaccct
ctgagtgggagccaggtcaaagtggaacaattgtttgaggactctgggaacaggaggagt
agtacccttcagtctgcaggaattacttgttcagaaagatctcttccttccctgacaaaa
gataaaagcatagagagcttaagcacttctaaaggtggcagcagttcctcaaaagcccac
aaagccgtttcccaggctccagaacaagctgtcaaacagtacaagcatcaattatctgcg
tatgagcagcaagagatatttaacttctctgagatttactttgtgggtccagctgcaaag
aagaggcaaggagtgattggtggacccaacaacggaggttatgatgatgaccaaggcagc
tacattcatgtgccccacgaccatctcgcttaccgctatgaagtgctcaaaatcattggc
aagggcagttttggacaagttgctaaagtctatgatcacaaactccaccagcatttagcc
ttaaagatggttcgtaatgaaaagagattccatcggcaagcagcagaagaaatccggatc
ctggagcacctgaagaagcaggataaaactggcagtatgaacgttattcacatgctggaa
agcttcacctttcggaaccacatctgtatgacctttgaactcttgagtatgaacttgtac
gagctgataaaaagaaataagttccagggcttcagcatccagctggtgcgcaagtttgct
cactctatactgcagtgcttggatgctctctatagaaacaaaatcatacactgtgacttg
aagccggaaaatatcctcctcaaacagcaagggaggagtggaatcaaggttatagatttt
gggtccagctgttttgagcaccaaagagtctacacgtacattcagtctcgattttatcga
gcaccggaggtaattctagggagtcgctatgggatgcccatagatatgtggagttttggc
tgtattctggtggagctattgactggataccctctttttcctggagaggacgagggagac
caattggcttgtatgatggaacttcttggaatgccccctcagaagcttttggatcaatcc
aagcgagccaagaactttatcaactccaagggtcatcctcgctactgcactgtaactaca
catgcagatggaagagtgaccctcaacgggagccgatcgcgcaggggaaaagtgcgaggt
gctccagggaacaaggactgggtgacagcactgaaaggctgcgacgatcccttgttcata
gagttcttaaaggaatgtctcagctgggaccctgctgtgcgcatgactccaagtcaagct
ttaaggcacccctggatttgcaaacgaacacccaaaccacccagcactgataaaacctcc
agtaaaaggatttctagctacacgagttccttcacaggaattggttccaagttgcctcct
gtggtcggggtagcaaacaagctgagggctaacttaacatccgatgccaatggcagtata
cctttatgtactgtgctgccgaagctggtcagctag

DBGET integrated database retrieval system