KEGG   Meleagris gallopavo (turkey): 100548368Help
Entry
100548368         CDS       T01523                                 

Definition
dual specificity tyrosine-phosphorylation-regulated kinase 3-like
Orthology
K08825  
dual-specificity tyrosine-(Y)-phosphorylation regulated kinase [EC:2.7.12.1]
Organism
mgp  Meleagris gallopavo (turkey)
Brite
Enzymes [BR:mgp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     100548368
Protein kinases [BR:mgp01001]
 Serine/threonine protein kinases: CMGC group
  DYRK family [OT]
   100548368
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
28
AA seq 595 aa AA seqDB search
MAPCAAQRVRVETTRPTGPARGEKGKFEPPGFVLWFGDGLYDSYMRIDQLRYQESANEEH
SPSGLPSLGRSNVCSNKLAMKDHPLSGSQVKVEQLFEDSGNRRSSTLQSAGITCSERSLP
SLTKDKSIESLSTSKGGSSSSKAHKAVSQAPEQAVKQYKHQLSAYEQQEIFNFSEIYFVG
PAAKKRQGVIGGPNNGGYDDDQGSYIHVPHDHLAYRYEVLKIIGKGSFGQVAKVYDHKLH
QHLALKMVRNEKRFHRQAAEEIRILEHLKKQDKTGSMNVIHMLESFTFRNHICMTFELLS
MNLYELIKRNKFQGFSIQLVRKFAHSILQCLDALYRNKIIHCDLKPENILLKQQGRSGIK
VIDFGSSCFEHQRVYTYIQSRFYRAPEVILGSRYGMPIDMWSFGCILVELLTGYPLFPGE
DEGDQLACMMELLGMPPQKLLDQSKRAKNFINSKGHPRYCTVTTHADGRVTLNGSRSRRG
KVRGAPGNKDWVTALKGCDDPLFIEFLKECLSWDPAVRMTPSQALRHPWICKRTPKPPST
DKTSSKRISSYTSSFTGIGSKLPPVVGVANKLRANLTSDANGSIPLCTVLPKLVS
NT seq 1788 nt NT seq  +upstreamnt  +downstreamnt
atggcaccgtgcgctgctcaacgagtccgggtggaaacaacccgcccgaccgggccggcc
cgaggagaaaagggaaagtttgagccgccgggctttgtcctatggtttggagacggatta
tatgactcctatatgaggatagatcagcttaggtaccaagagtctgcaaatgaagagcac
agcccctcaggactgccttcccttgggagatctaacgtttgtagcaacaaacttgcaatg
aaggatcaccctctgagtgggagccaggtcaaagtggaacaattgtttgaggactctggg
aacaggaggagtagtacccttcagtctgcaggaattacttgttcagaaagatctcttcct
tccctgacaaaagataaaagcatagagagcttaagcacttctaaaggtggcagcagttcc
tcaaaagcccacaaagccgtttcccaggctccagaacaagctgtcaaacagtacaagcat
caattatctgcgtatgagcagcaagagatatttaacttctctgagatttactttgtgggt
ccagctgcaaagaagaggcaaggagtgattggtggacccaacaacggaggttatgatgat
gaccaaggcagctacattcatgtgccccacgaccatctcgcttaccgctatgaagtgctc
aaaatcattggcaagggcagttttggacaagttgctaaagtctatgatcacaaactccac
cagcatttagccttaaagatggttcgtaatgaaaagagattccatcggcaagcagcagaa
gaaatccggatcctggagcacctgaagaagcaggataaaactggcagtatgaacgttatt
cacatgctggaaagcttcacctttcggaaccacatctgtatgacctttgaactcttgagt
atgaacttgtacgagctgataaaaagaaataagttccagggcttcagcatccagctggtg
cgcaagtttgctcactctatactgcagtgcttggatgctctctatagaaacaaaatcata
cactgtgacttgaagccggaaaatatcctcctcaaacagcaagggaggagtggaatcaag
gttatagattttgggtccagctgttttgagcaccaaagagtctacacgtacattcagtct
cgattttatcgagcaccggaggtaattctagggagtcgctatgggatgcccatagatatg
tggagttttggctgtattctggtggagctattgactggataccctctttttcctggagag
gacgagggagaccaattggcttgtatgatggaacttcttggaatgccccctcagaagctt
ttggatcaatccaagcgagccaagaactttatcaactccaagggtcatcctcgctactgc
actgtaactacacatgcagatggaagagtgaccctcaacgggagccgatcgcgcagggga
aaagtgcgaggtgctccagggaacaaggactgggtgacagcactgaaaggctgcgacgat
cccttgttcatagagttcttaaaggaatgtctcagctgggaccctgctgtgcgcatgact
ccaagtcaagctttaaggcacccctggatttgcaaacgaacacccaaaccacccagcact
gataaaacctccagtaaaaggatttctagctacacgagttccttcacaggaattggttcc
aagttgcctcctgtggtcggggtagcaaacaagctgagggctaacttaacatccgatgcc
aatggcagtatacctttatgtactgtgctgccgaagctggtcagctag

DBGET integrated database retrieval system