KEGG   Meleagris gallopavo (turkey): 100548472Help
Entry
100548472         CDS       T01523                                 

Gene name
USP5
Definition
ubiquitin specific peptidase 5 (isopeptidase T)
Orthology
K11836  
ubiquitin carboxyl-terminal hydrolase 5/13 [EC:3.4.19.12]
Organism
mgp  Meleagris gallopavo (turkey)
Brite
Enzymes [BR:mgp01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100548472 (USP5)
Peptidases [BR:mgp01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100548472 (USP5)
Exosome [BR:mgp04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100548472 (USP5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
1
AA seq 876 aa AA seqDB search
MNKNVKDIRSDVLVSPSSCELHDETAEGVDSIPRGNLNSWNGILCCFPSVFLSPSFQESD
GGLYICMNTFLGFGKQYVEKHYQKTGQRVYLHLKRTRKPKEEDANSSAGDPPRKKPTRLA
IGVEGGFDITEEKFEYDEDVKIVILPEHLDIPRDGLEGLPDMVRDRIANAVEAILTADSA
SRKQEVQAWDGEVRRVSKHAFSLHQLQNDVRIPPCGWKCSKCDMRENLWLNMTDGAILCG
RRYFDGSGGNNHAVEHYRETGYPLAVKLGTITPDGADVYSYDEDDMVLDPNLAEHLAHFG
IDMLKMQKTDKTMTELEIDMNQRIGEWELIQESGVQLKPLYGPGYTGIRNLGNSCYLNSV
MQVLFSIPDFQRKYVDKLEKIFQSAPSDPTQDFSTQVAKLGHGLLSGEYSKPASAEGEQQ
PDQKGVQNGIAPRMFKSLIGKGHPEFSTNRQQDAQEFFLHFINMVERNCRSSENPNEVFR
FLVEEKLKCLATEKVKYTQRVDYIMQLPVPMDAALNKDELLEYEEKKRQAEEEKQPLPEL
VRAKVPFSSCLEAYGAPEQVDDFWSTALQAKSVALKTTRFASFPDYLVIQIKKFTFGLDW
VPKKLDVSIEMPEELDISALQGMGLQDGEEEMPDIAPPLVTPDEPKGSLGFYGNEDDDSF
CSPHFSSPTSPMLDESVIIQLVEMGFPMDACRKAVYYTGNSGVEAAMNWVMSHMDDPDFA
NPLVLPGSSGPGSTIACPDPPSEDSVATIVSMGFSRDQAMKALRATNNSLERAVDWIFSH
IDDLDAEAAMDISEGRSAADSISESVPIGPKVRNGPGKYQLFAFISHMGTSTMCGHYVCH
IKKDGRWVIYNDQKVCASEKPPKDLGYIYFYQRIPS
NT seq 2631 nt NT seq  +upstreamnt  +downstreamnt
atgaacaagaatgtgaaagacataagatcagatgtgctggtaagcccctcctcctgtgaa
ctgcatgatgaaacggctgagggagttgatagcattccaagaggtaaccttaacagttgg
aatggcattctttgctgtttcccttcagtttttctctccccttccttccaggagtctgat
ggcggcttatatatctgcatgaacacgttcctgggttttggaaaacagtatgtggaaaag
cactaccagaaaacaggccagcgggtctatctgcacctcaaaagaacacgtaaaccgaag
gaagaagatgctaattccagtgctggggaccccccaaggaagaaaccaactcgcttggct
attggtgtggaaggtggatttgacatcacagaggaaaagtttgaatatgatgaagatgta
aaaatagttattctcccggaacatttggatattccccgtgatggactggagggactacct
gacatggtcagagacaggattgccaatgcggttgaagccatccttacagcagactcagct
tcccggaagcaggaggtgcaggcttgggatggggaggttcgacgtgtttctaaacacgct
ttttccctgcaccaacttcagaatgatgtccgcatcccaccatgtggctggaagtgcagc
aaatgtgacatgagggagaacctgtggctgaacatgactgatggagccatcctctgcggc
cggcgctattttgatggcagtggtggcaacaatcatgcagtcgagcactaccgggaaact
ggctacccactggctgtgaaactgggaacaattactcctgatggggctgatgtctactca
tacgatgaggatgacatggtgttggatcccaacttggcagagcacctcgctcactttggg
attgacatgctcaagatgcaaaagacagacaagacaatgacagaactggaaatagatatg
aatcaacgtattggggagtgggagctcatccaggagtctggtgtgcagctcaagcccctc
tatgggcctgggtacactggtatccgtaacctgggcaacagttgctacctcaattctgtg
atgcaggtgctgttcagtattccagacttccagagaaagtatgtggacaagctggagaag
atattccaaagtgcaccttcggatcccacacaggacttcagcacacaagtagccaaactg
ggtcatggtctgctatctggggagtattcaaagccagcttctgcagaaggggaacagcag
cctgatcagaagggtgtacaaaatggcattgctccacgcatgtttaagtccctcattgga
aagggacacccagaattttccactaaccggcagcaggatgcccaggaattctttctgcac
ttcatcaacatggtggagaggaactgccgcagctcggagaaccctaatgaggtcttccgt
tttctggtggaggagaagctgaaatgtctggccacagaaaaggtgaaatacacccagcgt
gtggactacatcatgcagctgccagtacccatggatgctgcgctcaacaaagatgagcta
ctggaatatgaggagaagaagcggcaggcagaggaagagaagcagccactgcctgagctg
gtgcgagccaaggtgcctttcagctcctgcctagaggcctatggagctccggagcaggtg
gatgatttctggagcacagccttgcaggccaagtctgtggctctcaaaacaacgcggttc
gcctctttcccagattatctggtgattcagatcaagaaattcacttttggtctggattgg
gtgcccaaaaagcttgatgtctccattgaaatgccagaggagctggatatctctgcactg
cagggaatggggctgcaggatggagaagaagaaatgccagacattgcacccccactggtg
acaccagatgagcccaaaggtagcctggggttctatggcaacgaggacgacgactccttc
tgctcccctcacttctcctctccgacatcccccatgttggatgagtcagtgattatccaa
ctagtggagatgggctttcccatggatgcttgccgcaaagcagtgtattacacagggaac
agtggggttgaagctgccatgaactgggtcatgtcacacatggatgatccagattttgct
aacccattagttctccctggatccagtggaccagggtcgactattgcctgtccagaccct
ccatccgaagacagtgtggccaccattgtctccatgggcttctcccgggaccaggctatg
aaagcacttagagcaacgaacaacagcctggagcgtgcagtggattggatctttagtcac
attgatgaccttgatgcagaagctgctatggatatctcagaggggcgctcggcagccgac
tccatctctgaatctgttcctattggtcctaaagtgcgcaatgggcctggaaaatatcag
ttgtttgccttcatcagccacatgggcacttcgactatgtgtggtcactatgtttgtcac
atcaagaaagatggcaggtgggtgatctataatgaccagaaggtctgtgcttctgagaag
ccccccaaggacctgggctacatctacttctatcagcggattcccagctag

DBGET integrated database retrieval system