KEGG   Meleagris gallopavo (turkey): 100548538Help
Entry
100548538         CDS       T01523                                 

Gene name
TMX3
Definition
thioredoxin-related transmembrane protein 3
Orthology
K09585  
thioredoxin domain-containing protein 10 [EC:5.3.4.1]
Organism
mgp  Meleagris gallopavo (turkey)
Brite
Enzymes [BR:mgp01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     100548538 (TMX3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
3
AA seq 432 aa AA seqDB search
MDTCPGKVKRFKENRKDDIWLVDFYAPWCGHCKKLEPVWNEVGIEMKNMGSPVRVGKMDA
TSFSSIASEFGVRGYPTIKLLKGDLAYNYRGPRTKDDIIEFANRVAGPLIRPLPSQHMFE
HVRKRHRVFFVYVGGESPLKEKYIEVASELIVYTYFFSASEDMLPEYLTLPELPAVVVFK
DGTYFVYDEYEDGDLSSWINRERFQGYLTVDGFTLYELGDTGKLVAIAVIDDKNSSVEHT
RLKSIIQEVARDYRDHFHRDFQFGHMDGNDYINSLLMDDLTIPTIVVLNTSNQQYFLPDR
HIENTEDMVQFINNILDGTAEAQGGDGVLQRIKRIVYDAKSTVVSVFKSSPLLGCFLFGL
PLGVISIMCYGICTADTDGGVDEHEAVKKENSDRELTDDGSEEEKEEEKNGKYAELSDGE
LKQKDLLEKKKD
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atggacacatgccctggaaaagtgaaaaggtttaaagaaaaccgtaaagatgatatttgg
cttgtagatttttatgcaccgtggtgtggccactgcaagaaattagagcctgtgtggaat
gaagtgggtatagaaatgaaaaacatgggctctccagtaagagttgggaagatggatgca
acttccttctctagtattgcatctgaattcggagtgcgaggctatccaacaattaagctc
ttaaaaggtgacttggcatacaactatagaggacctaggaccaaagatgatataattgaa
ttcgctaatagagtagcaggacctcttatcaggccacttcctagccagcatatgtttgag
catgtgcgaaagaggcatcgtgtattttttgtatatgttggtggggaatctcctttaaag
gaaaaatacattgaagttgcttcagaactaattgtttatacatactttttttctgcctca
gaagatatgctccctgagtatctgaccttgcctgaactacctgctgttgtcgtattcaaa
gatggaacttactttgtgtatgatgagtatgaagatggtgatttgtcatcctggataaat
cgagaaagatttcaaggttatcttactgtagatggttttacattgtacgaacttggagat
acaggaaaacttgtggctattgcagtcattgatgacaaaaactcttcagtggaacatacc
agactgaaatctattattcaggaagttgcaagagattatcgggatcactttcacagggat
ttccagttcggccatatggatggaaatgattacatcaatagcttattaatggatgacttg
acaattcctactatcgttgttttgaatacctccaatcagcagtattttctaccagatagg
cacattgagaacacagaagatatggttcagtttattaacaatatcttggatggtacggct
gaagcacaaggtggtgacggagttctgcagcgaatcaagagaatagtctatgatgccaag
tctactgttgtgtcagtgttcaagagttcaccacttctgggatgctttctctttgggtta
cccctgggtgtcatcagcataatgtgttacggaatctgcacagctgatacagatggaggt
gtagatgaacacgaggcagttaaaaaggaaaacagcgatcgggagctcacagatgatggc
agtgaggaggagaaagaggaggaaaagaacggaaaatatgcagaactttcagatggagag
cttaaacagaaagacctactagaaaagaaaaaagactaa

DBGET integrated database retrieval system