KEGG   Meleagris gallopavo (turkey): 100548556Help
Entry
100548556         CDS       T01523                                 

Definition
beta-galactoside alpha-2,6-sialyltransferase 1-like
Orthology
K00778  
beta-galactoside alpha-2,6-sialyltransferase (sialyltransferase 1) [EC:2.4.99.1]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
N-Glycan biosynthesis
Other types of O-glycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mgp00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    100548556
   00514 Other types of O-glycan biosynthesis
    100548556
Enzymes [BR:mgp01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.99  Transferring other glycosyl groups
    2.4.99.1  beta-galactoside alpha-2,6-sialyltransferase
     100548556
Glycosyltransferases [BR:mgp01003]
 Terminal extension
  Sialyltransferase
   100548556
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
11
AA seq 413 aa AA seqDB search
MVHINVLKKCMCVLVVLLIALTVCLWKETRGSYYVPFKNDDTQVHRTLEKWNLLKSQGLF
HEAAGEMGQMPKALPDDQNKVKGITSGVVEKSRKAADHVKVWDKDSSSRNLIPRLQKVRK
NYLSMNKYNVTYNGKMNAAKLSPEKLLCQLRVRVNVTMIQGSDGPFNSSEWQHYLPEKSL
NETVGRLGRCAVVSSAGSLKSSHLGPEIDSHDAVLRFNGAPVKGFQEDVGQKTTIRLVNS
QLVTVEEQQFLKDALYNTGILIVWDPAPYHAEIHEWYQKPDYKFFEAYKLYRIRHPEQPF
YILNPKMQWQLWDILQENSLEHIQPNPPSSGMLGIVIMMTLCDEVDVYEFLPSKRQTDIC
HYYQKFHDRACTMGAYHPLLFEKNLVKHLNQGTDEDIYTHGKVTLPGFRNVHC
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
atggttcacatcaatgtgctgaaaaaatgtatgtgtgttcttgtggtgttactgatagct
ctgacagtttgcctgtggaaagagacaagaggaagctattatgttcctttcaagaatgat
gatacacaggttcacaggactttggaaaaatggaacctacttaaatcacagggcctcttc
cacgaagctgctggtgaaatgggtcagatgcctaaagctttgccagatgaccaaaataaa
gtaaaaggcatcacctctggagtagtggagaagtccaggaaagcagcagaccatgtgaag
gtatgggataaggacagctcatccagaaacctcatacccaggctgcagaaggtcaggaag
aattacctgtccatgaacaagtacaacgtgacttacaacgggaagatgaatgctgctaaa
ctcagcccagagaagctgctgtgccagctgcgggtcagggtgaacgtgaccatgatacag
ggatcagatgggccatttaattcctcggaatggcagcactacctcccagagaaaagcctc
aatgaaacagtgggccgcctgggtcgctgcgctgttgtgtcctcagcaggctctctgaaa
tcgtctcacttgggaccggagatagacagccatgatgccgtcttgcggtttaatggggct
cctgtcaagggatttcaagaagatgtgggtcaaaaaacaacgatccgtcttgttaactcc
cagctggtcactgttgaggagcagcagttcctgaaagatgctctgtataacactggaatc
ttgattgtctgggatccagcgccatatcatgcagaaatacatgagtggtaccaaaaacca
gactacaagttttttgaagcctacaagttgtatcgtattagacatccggagcagcccttt
tatatcctgaatccaaagatgcagtggcaactctgggatattctgcaggagaattccctg
gagcatattcagcctaacccaccatcttcaggaatgctgggcattgtgatcatgatgacg
ctctgcgacgaggtggatgtgtatgaatttctcccttctaagcggcagacggacatttgc
cactactaccagaagtttcacgaccgtgcctgcaccatgggagcctaccaccctctcttg
tttgagaaaaacttggtgaagcatttaaaccaaggcaccgatgaggacatctatactcac
gggaaggttactttgcccggcttccgaaatgtacattgctag

DBGET integrated database retrieval system