KEGG   Meleagris gallopavo (turkey): 100548558Help
Entry
100548558         CDS       T01523                                 

Definition
mitogen-activated protein kinase 6-like
Orthology
K06855  
mitogen-activated protein kinase 4/6 [EC:2.7.11.24]
Organism
mgp  Meleagris gallopavo (turkey)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
12
AA seq 721 aa AA seqDB search
MAEKFESLMNIHGFDLGSRYMDLKPLGCGGNGLVFSAVDNDCDKRVAVKKIVLTDPQSVK
HALREIKIIRRLDHDNIVKVFEILGPSGSQLTDDVGSLTELNCVYIVQEYMETDLANLLE
QGPLLEDHARLFMYQLLRGLKYIHSANVLHRDLKPANLFINTEDLVLKIGDFGLARIMDP
HYSHKGHLSEGLVTKWYRSPRLLLSPNNYTKAIDMWAAGCIFAEMLTGKTLFAGAHELEQ
MQLILESIPVVHEEDRQELLNVIPVYIRNDMTEPHKPLTQLLPGISPEALDFLEQILTFS
PMDRLTAEEALSHPYMSIYSFPTDEPISSHPFHIEDEVDDILLMDESHSHIYNWERYHES
QFSDHDWPIHNNYEADEVQRDPRALSDVTDEEEVQVDPRKYLDGDREKYLEDPAFDTHFS
TEPCWQYSDHHENKYCDLECSHTCNYKMRSSSYLDNLVWRDSEVNHYYEPKLIIDLSNWK
EQSKEKSDKKGKSKCEKNGLVKAQIALEEASQQLVEKEREKNQGFDFDSFIAETIQLSLQ
HEPTDVDKLNDLNSSVSQMESKGLISKSVSREKQEKGMANLAQLGALYQTSWDSQFVSNG
EECFLIDQFCCEVRKDEQAEKENTYTSYLDKFFSKKEDAEMLEPEPVEEGKLGEKERGES
FLSNSGELLFNKQLEAIGIPQFHSPVGSPLKSIQATLTPSAMKSSPQIPHKTYSSILKHL
N
NT seq 2166 nt NT seq  +upstreamnt  +downstreamnt
atggcagaaaaatttgaaagtctcatgaacattcatggttttgatctgggctctcggtat
atggacttaaaaccactgggctgtggtggaaatggcttagttttttctgctgtcgacaat
gactgtgacaagagagtggctgtcaagaaaattgtccttacggatccccagagtgttaaa
catgctctacgtgagatcaaaattattagaagacttgaccacgataacattgtcaaagta
tttgaaattcttggtcctagtggaagccagctaacagatgatgtgggctccctgacagag
ctgaactgtgtttacattgtccaggaatacatggagacggatctggctaatctgctagag
caaggccctttactggaagatcatgccagacttttcatgtaccagctgctacgtgggctc
aagtatatccactctgcaaatgttctgcatagagatctcaaaccagctaaccttttcatt
aataccgaagacttggtgctgaagattggggacttcggtcttgcacgaatcatggatcct
cattattcccacaagggccatctttctgaaggattggtcactaaatggtacagatcaccc
cggcttttactttctcctaacaactacactaaagccattgacatgtgggctgcaggttgc
atctttgctgaaatgctgactgggaaaaccctctttgcaggtgcacatgaacttgaacag
atgcagttgattctagaatcaattcctgttgtacatgaggaggaccgtcaggagcttctc
aatgtaattccagtttacattagaaatgatatgactgagccacacaaacctttaactcag
ttgcttccaggcatcagtcctgaagcactggactttctggagcaaattttgacatttagt
cccatggatcgattgacagcagaagaagctttgtcccatccttacatgagcatttattcc
tttccaacggatgagcctatttcgagtcatccttttcacattgaagatgaggttgatgat
attctgctgatggatgaaagtcacagccatatttataattgggaaagataccatgaaagt
cagttttcagaccatgactggcctattcataataactatgaagctgatgaagttcagcgt
gatccaagggctctttctgatgttactgatgaggaagaagtgcaagtagatcctcgcaaa
tatttggatggagatcgtgaaaagtatctggaggatcctgcttttgacacccacttctct
actgagccttgctggcagtattcagatcaccatgaaaacaaatactgtgatctggaatgt
agtcacacttgtaattacaaaatgaggtcatcttcatacctagataatttagtttggcga
gacagtgaagttaaccattactatgagcccaagcttattatagatctgtcaaactggaag
gagcagagcaaagaaaagtctgataagaaaggcaagtctaaatgtgaaaagaatggattg
gtgaaagcccagatagcgcttgaggaagcatcacagcaacttgttgaaaaagaaagggag
aagaatcaaggatttgactttgattcgtttatagcagaaaccattcagcttagtttacaa
cacgagcctactgatgttgataaattaaatgacttgaatagctcggtgtctcagatggag
tcgaaaggattaatatcgaagtcggtaagcagagagaagcaggagaagggaatggctaac
ttggcacagttaggagctctgtaccaaacttcttgggacagtcagtttgtaagtaacggg
gaggagtgcttcctcatagaccagttctgttgtgaggtgaggaaagatgaacaagctgaa
aaagaaaatacttacaccagttatttggacaaattttttagtaagaaagaagatgctgaa
atgctagaacctgagccagtagaagaggggaagcttggggagaaggagagaggagagagc
tttctcagtaacagtggagaactcctcttcaacaagcagcttgaggctataggtattcct
cagtttcatagccctgttggttcgccactgaaatccatacaggccacgctaacgccttct
gctatgaaatcctctccccagattccccacaaaacatacagcagcattctgaaacatcta
aattaa

DBGET integrated database retrieval system