KEGG   Meleagris gallopavo (turkey): 100548595Help
Entry
100548595         CDS       T01523                                 

Definition
choline kinase alpha-like
Orthology
K14156  
choline/ethanolamine kinase [EC:2.7.1.32 2.7.1.82]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
Glycerophospholipid metabolism
Metabolic pathways
Module
Phosphatidylcholine (PC) biosynthesis, choline => PC
Phosphatidylethanolamine (PE) biosynthesis, ethanolamine => PE
Brite
KEGG Orthology (KO) [BR:mgp00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    100548595
Enzymes [BR:mgp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.32  choline kinase
     100548595
    2.7.1.82  ethanolamine kinase
     100548595
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
5
AA seq 389 aa AA seqDB search
MPQPVASRRARRVAAGRGGGGRPGLPRGGGRCRQGASKLANNPYPSLCRGGLSNMLFQCS
LPDSIETVADEPRKVLLRLYGAILQMRSCNKGESEQSQKENDLQGAEAMVLESVMFAILA
ERALGPKLYGIFPQGRLEEFIPSRKLSTEELSLPDISAEIAEKMAIFHGMKMPFNKEPKW
LFGTMEKYLNQVLRIKFTRESKTRKLNKLLSYNLPQEMKNLRAMLEATSSPVVFCHNDCQ
EGNILLLEGRENSEKQKLMLIDFEYSSYNYRGFDIGNHFCEWMYDYTYEKYPFFKASVLK
YPSKKQQLHFISSYLSAFQDGFENLSNEEKSKLEEEMLLEVNRFALASHFFWGLWSIIQA
KISSIEFGYLEYALSRFDVYFDQKKRLQV
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgccgcagccggtcgccagccggcgggcacggcgcgttgcggcggggcggggcggcgga
gggaggccggggctgccccgcggcggtggccgttgccggcaaggggcatctaaattagca
aataatccatacccttctctttgtagaggtggcctcagcaacatgctgtttcagtgctcg
ctacctgattccattgagacagttgcagatgagccacggaaagttctgctgcgtttatac
ggtgcaatcctgcagatgaggtcctgtaataaaggagaatcagaacagtctcaaaaggaa
aatgacttgcaaggggcagaagccatggttttggaaagtgttatgtttgccattctggca
gagcgagctcttggcccaaagctgtatggaatctttccgcaggggagactagaggaattt
attcctagcaggaaactaagtactgaagaacttagcttacccgacatatctgctgaaata
gctgagaagatggcaatatttcatggcatgaaaatgccatttaataaagaacctaagtgg
ctttttgggacaatggaaaagtatctaaatcaagtgctgaggataaaatttactagagaa
tccaaaactaggaaactgaacaaactcctcagttacaatttaccccaggaaatgaaaaat
ctaagagctatgcttgaggctacttcatcaccagttgtattttgccacaacgactgccag
gaaggtaatatcttgcttctagaaggcagagagaattcagaaaaacaaaagctgatgctc
atagactttgaatacagcagctataattaccgaggctttgatattgggaatcacttctgt
gaatggatgtatgattacacatatgagaagtatccattcttcaaagctagtgttcttaaa
tatccttcaaagaagcaacagcttcattttatctccagttacctgtctgcattccaagat
ggctttgaaaatctgagcaatgaagagaagtccaaactagaagaagaaatgttgctagaa
gttaataggtttgcccttgcatcacacttcttctggggtttgtggtctattatacaagca
aagatctcatccattgaatttggttacctggaatatgcattatccagattcgatgtgtac
ttcgatcagaagaagaggctccaagtatga

DBGET integrated database retrieval system