KEGG   Meleagris gallopavo (turkey): 100548630Help
Entry
100548630         CDS       T01523                                 

Gene name
TPI1
Definition
(RefSeq) triosephosphate isomerase 1
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:mgp00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    100548630 (TPI1)
   01230 Biosynthesis of amino acids
    100548630 (TPI1)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100548630 (TPI1)
   00051 Fructose and mannose metabolism
    100548630 (TPI1)
   00562 Inositol phosphate metabolism
    100548630 (TPI1)
Enzymes [BR:mgp01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     100548630 (TPI1)
Exosome [BR:mgp04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   100548630 (TPI1)
  Exosomal proteins of bladder cancer cells
   100548630 (TPI1)
  Exosomal proteins of melanoma cells
   100548630 (TPI1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
1
AA seq 235 aa AA seqDB search
MNGDKKSLGELIHTLNGAKLSADTEVVCGAPSIYLDFARQKLDAKIGVAAQNCYKVSKGA
FTGEISPAMIKDIGAAWVILGHSERRHVFGESDELIGQKVAHALAEGLGVIACIGEKLDE
REAGITEKVVFEQTKAIADNVKDWSKVVLAYEPVWAIGTGKTATPQQAQEVHEKLRGWLK
SHVSDAVAQSTRIIYGGSVTGGNCKELASQHDVDGFLVGGASLKPEFVDIINAKH
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atgaacggcgacaagaagagcttgggcgagctcatccacacgctgaatggcgccaagctc
tcggccgacaccgaggtggtttgtggagccccttcaatctaccttgattttgcccgtcag
aaacttgatgctaagattggagttgcagcacaaaactgttacaaggtatcgaagggtgct
ttcacaggagagatcagcccagcaatgatcaaagatattggagctgcgtgggttatcctg
ggccactcagagcggaggcatgtttttggagagtctgatgagttgattggacagaaggtg
gctcatgctcttgctgagggccttggtgtcatcgcctgcattggggagaagctggatgag
agagaagctggcataacggagaaggtggtctttgaacagaccaaagctattgctgataac
gtgaaggactggagtaaagtcgttcttgcctatgagccagtttgggctattggaactggc
aaaactgctactccccaacaggctcaggaagttcatgagaagctgaggggctggctcaaa
agccatgtgtctgatgctgttgctcagtcaactaggattatctatggaggttcagtcact
ggtggcaactgtaaggaactggcctctcagcatgatgtagatggcttccttgttggtggg
gcttctctcaagccggagtttgtggatattatcaatgcaaaacattaa

DBGET integrated database retrieval system