KEGG   Meleagris gallopavo (turkey): 100548630Help
Entry
100548630         CDS       T01523                                 

Definition
triosephosphate isomerase-like
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Class
Metabolism; Overview; Carbon metabolism [PATH:mgp01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:mgp01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:mgp00010]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:mgp00051]
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:mgp00562]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1
AA seq 224 aa AA seqDB search
MEKGHCVGLVRRGEVVCGAPSIYLDFARQKLDAKIGVAAQNCYKVSKGAFTGEISPAMIK
DIGAAWVILGHSERRHVFGESDELIGQKVAHALAEGLGVIACIGEKLDEREAGITEKVVF
EQTKAIADNVKDWSKVVLAYEPVWAIGTGKTATPQQAQEVHEKLRGWLKSHVSDAVAQST
RIIYGGSVTGGNCKELASQHDVDGFLVGGASLKPEFVDIINAKH
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atggagaagggacattgcgtgggtctcgtgcggaggggggaggtggtttgtggagcccct
tcaatctaccttgattttgcccgtcagaaacttgatgctaagattggagttgcagcacaa
aactgttacaaggtatcgaagggtgctttcacaggagagatcagcccagcaatgatcaaa
gatattggagctgcgtgggttatcctgggccactcagagcggaggcatgtttttggagag
tctgatgagttgattggacagaaggtggctcatgctcttgctgagggccttggtgtcatc
gcctgcattggggagaagctggatgagagagaagctggcataacggagaaggtggtcttt
gaacagaccaaagctattgctgataacgtgaaggactggagtaaagtcgttcttgcctat
gagccagtttgggctattggaactggcaaaactgctactccccaacaggctcaggaagtt
catgagaagctgaggggctggctcaaaagccatgtgtctgatgctgttgctcagtcaact
aggattatctatggaggttcagtcactggtggcaactgtaaggaactggcctctcagcat
gatgtagatggcttccttgttggtggggcttctctcaagccggagtttgtggatattatc
aatgcaaaacattaa

DBGET integrated database retrieval system