KEGG   Meleagris gallopavo (turkey): 100548683Help
Entry
100548683         CDS       T01523                                 

Definition
ubl carboxyl-terminal hydrolase 18-like
Orthology
K11846  
ubiquitin carboxyl-terminal hydrolase 18/41 [EC:3.1.2.15]
Organism
mgp  Meleagris gallopavo (turkey)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1
AA seq 416 aa AA seqDB search
MKAPLLCGRWPLPLTQPGGARQSLSGSAAAAAAPSALPAGPKCPSRCGPFVIVHTILLMS
QRGEHQESKKELERSPSETMKAEESYEEDKVPKSEDWRPPSVFGAADLKNRAVGLYNIGQ
TCCLNSLLQVFFMNIHFTKILRRISVPVCGTRRKNVPYQMLLLLEKMQHGKQKAVSPREL
AICLLAHGVTMFVQYDAAQLFLTLWNLLKKQMKNPELVEKLSDLYTISVQEHLACQTCSS
ETKRNSSMLTLPVSLLDSGFHMLKTLEECLQCFFHPEELTGHNMCFCEHCGKKTPFWQSV
KLVHLPQILTIHLKRFCFGRSAYIHKISNCLPFPQDLDFSAVLTEQQCQAYDNEKAAWQY
ELFAVVAHSGSTSCGHYCAYIRSLTECKWYCFNDSFVEQVSWDDVKSTYGHSDLSW
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
atgaaagctccgctgctttgcgggcgttggccgctgcctctgacgcagccgggaggagcg
cggcaatctctctcaggcagcgccgccgcggcagccgctccctcagcgctgcccgcggga
ccgaagtgcccttcgcgctgcggtccttttgtgattgtacatacgatattattgatgagc
caaagaggtgagcatcaagaaagcaagaaggaactagagagatcaccaagtgagaccatg
aaggcagaagaaagttatgaagaagacaaagtgccaaagagtgaagactggaggccacca
tcagtctttggagctgcagacttaaaaaatagagctgttggactgtataatattggacaa
acctgctgtctgaactctctgctccaagtgttcttcatgaacatacacttcacaaagata
ctgcgaaggatctcagtgccagtgtgtggcacacgaaggaagaatgtcccataccaaatg
cttttgctgctggagaagatgcagcatggaaagcagaaagcagtttctcccagagagctt
gctatctgtcttttagcacatggagtgacaatgtttgtacagtatgatgctgcccaactc
tttttgactctttggaacttgttaaagaaacagatgaaaaacccagagctggttgaaaag
ctgagtgatttgtacaccatcagtgtgcaggagcacctggcctgtcagacatgctcttct
gaaacaaaaaggaacagcagcatgttaacccttccagtctcattactagattctggcttt
cacatgctgaagactctggaggaatgcctgcagtgctttttccatccagaagagttgact
ggtcacaacatgtgtttctgtgaacactgtggaaagaaaacaccattttggcagagtgta
aagctggtccacctgccacagattctgaccatacacctaaagcgcttctgctttggaaga
tcagcttacatccacaaaattagcaactgtctgccattcccacaagaccttgatttcagt
gcagtcttgacagaacagcagtgccaagcatatgacaatgagaaggctgcctggcagtat
gagctctttgctgttgttgctcattcaggatcaactagctgtggacattactgtgcctat
attcgaagtctcacggaatgcaaatggtattgcttcaatgattcttttgttgaacaggtg
tcatgggatgatgttaaaagtacctatgggcattcagacctcagctggtaa

DBGET integrated database retrieval system