KEGG   Meleagris gallopavo (turkey): 100548758Help
Entry
100548758         CDS       T01523                                 

Definition
ubiquitin carboxyl-terminal hydrolase 13-like
Orthology
K11836  
ubiquitin carboxyl-terminal hydrolase 5/13 [EC:3.1.2.15]
Organism
mgp  Meleagris gallopavo (turkey)
Brite
Enzymes [BR:mgp01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     100548758
Peptidases [BR:mgp01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100548758
Exosome [BR:mgp04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100548758
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
11
AA seq 837 aa AA seqDB search
MCLTSFVGSCGRGINVVQPFLRVSAQDSEGGLYVCMNTFLGFGREHIERHYRKTGQCVYL
HLKRHVIEKVPGASGGALPKRRNAKLFLDLEANGDLSSDDFEYEDEAKLVIFPDHYEISL
PNIEELPALVTIASDALLSAKSPYRKQDPDSWEEELQASKHAKSLVQLDNGVRIPPSGWK
CSKCDLRENLWLNLTDGSVLCGKWFFEVXWGNGHAMEHYKETGYPLAVKLGTITPDGADV
YSFDEEEPVLDPHIAKHLAHFGIDMLQMQVAENGLRDNDIKPRVSEWEVIQEAGVKLKPM
YGPGYTGMKNLGNSCYLNAVMQAIFSIPEFQRAYVGNLQRIFDYSPLDPTQDFNTQMAKL
GHGLLSGQYSKPPMKSELIEQVMKEEHKPQQNGISPQMFKAFISKDHTEFSSNRQQDAQE
FFLHLINLVERNPVGSENPSDVFRFLVEERTQCCQSRKVRYTERVDYIMQLPVAMEAATN
KDELIAYELKRREAEAARRAPPELVRAKIPFSACLQAFSEPSNVEDFWSSALQAKSAGVK
TSRFASFPQYLVVQIKKFTFGLDWIPKKLDVSIDMPDFLDINHLRAMGLQPGEEELPDIA
PPIIIPEDPKDRMVNHFVESLDIDESSVMQLAEMGFPLEACRKAVYYTGNLGAEVAFNWI
IAHMEEPDFAEPLVVPVFGGTASSGVAGFGAVGLDNQPPEEMVSIIISMGFQRSLAIQAL
KATNNNLERALEWIFNHPELEEEDGEPALSMMDLENHTNANILAEARSEGPRIKDGPGRY
ELFGFISHMGTSTMSGHYVCHLKKEGRWVIYNDLRVCASERPPKDLGYIYFYHRIPS
NT seq 2514 nt NT seq  +upstreamnt  +downstreamnt
atgtgcttaacaagttttgttggttcttgtggaaggggaatcaacgtagtgcagcccttc
cttcgggtttctgctcaggattcagaaggaggtctctatgtgtgcatgaacacgtttctg
ggatttggaagggaacacattgaaaggcattaccggaaaacaggacagtgtgtgtatttg
catctgaaacgacatgtgatagagaaggtaccaggggcatctggtggagctttaccaaaa
aggaggaatgctaagctatttttagatctagaagcaaatggtgatctgagcagtgatgac
tttgaatatgaagatgaagcaaaactcgttatatttcctgatcactatgaaatctcatta
ccaaacatagaagagttaccagcactggtgacaatagcttctgatgcactcctcagtgca
aaatcaccctacaggaagcaggaccctgactcctgggaagaagagctacaggcatctaag
catgccaaatcgcttgtgcagttagacaatggtgttagaattccccccagtggttggaag
tgctcaaaatgtgatcttcgggagaatctgtggctaaacctgacagatggttcagtgttg
tgtgggaagtggttctttgaggtanngtgggggaatggccacgcaatggagcactacaag
gagacgggttatcccctggcagtgaagttgggaaccatcactcctgatggagcagatgtc
tattcctttgatgaagaggagccggtgttagatccacatatagcaaagcatctggcacac
tttgggattgatatgctgcagatgcaagtggcagagaatgggctaagagataatgatata
aaaccaagagtctctgaatgggaagtgattcaggaagctggtgtgaaactcaagcccatg
tatggcccaggatataccggcatgaagaacctgggaaatagctgctacctcaatgctgtc
atgcaagccattttcagcatcccagagttccagcgagcgtacgtaggaaaccttcagaga
atatttgactactccccgcttgatccaacacaagatttcaacacccagatggctaaactg
ggacatggcctcctttcaggccagtattctaaaccacccatgaaatctgagcttattgaa
caggtgatgaaagaagaacacaagcctcaacaaaatggaatatctccccagatgtttaag
gcttttataagtaaagaccacacagaattttcctctaatagacaacaagatgcgcaggag
tttttcctacatcttataaatctagtagagaggaatcctgtaggttcagaaaaccccagt
gatgttttccgtttcctggtggaagaacgcacacaatgctgccagtccagaaaagtccgc
tacactgagagggtggactacatcatgcagttacctgttgccatggaggcagcaacaaac
aaagatgaattaattgcgtatgagctgaaaaggcgagaagcagaagctgcaaggagagct
ccaccagaacttgtccgtgccaagatcccatttagtgcatgtttgcaggccttctctgaa
ccaagcaatgtagaggacttctggagcagtgcccttcaagcaaaatctgcaggagttaag
acttctcgttttgcttcgtttcctcagtacttggtggtacagataaagaagttcaccttt
ggccttgactggatacccaaaaagcttgatgtttcgatagacatgccagatttcctagat
atcaaccaccttcgagccatgggtctccagccaggagaagaggaacttcctgacattgca
cctcccattatcattcctgaagacccaaaagatcgtatggtgaaccattttgtggagtct
ctagatattgatgagtcttcggttatgcaactggcagagatgggttttcctttggaagca
tgtcggaaagctgtgtactatacaggcaacctgggtgctgaagtggctttcaactggatc
attgcacacatggaagagccagactttgctgaaccattggttgtacctgtgtttggagga
actgcttccagtggtgtggctggctttggggctgttggattggataatcaacctcccgaa
gagatggtctccatcatcatttccatgggcttccaaaggagcctagcaattcaagctctg
aaggcaacaaacaataacttggagcgtgcattggaatggatcttcaaccaccctgaatta
gaggaggaagatggggagcctgctttgagcatgatggatttggagaaccatactaatgca
aatatccttgcagaggcaagatcagagggacccaggatcaaagacgggcctggaaggtat
gagctgtttgggttcatcagccacatgggaacatccacaatgagtggtcactacgtttgt
catctcaaaaaagaaggaagatgggtgatctacaatgaccttagagtctgtgcctcagaa
cgacctcccaaagacctgggctatatttatttttaccacaggataccaagttag

DBGET integrated database retrieval system