KEGG   Meleagris gallopavo (turkey): 100548787Help
Entry
100548787         CDS       T01523                                 

Definition
pyruvate dehydrogenase (acetyl-transferring) kinase isozyme 3, mitochondrial-like
Orthology
K00898  
pyruvate dehydrogenase kinase 2/3/4 [EC:2.7.11.2]
Organism
mgp  Meleagris gallopavo (turkey)
Brite
Enzymes [BR:mgp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.2  [pyruvate dehydrogenase (acetyl-transferring)] kinase
     100548787
Protein kinases [BR:mgp01001]
 Serine/threonine protein kinases: Atypical group
  PDHK family [OT]
   100548787
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
1
AA seq 202 aa AA seqDB search
MDTFSIIFIQNVSTVHYEFTAKAPNKPIQVVYVPSHLFHMLFELFKNSMRATVELHEGKR
EGYPSIKTLVTLGKEDLSIKISDQGGGVPLRKIDRLFNYMYSTAPRPSLEPTRAVPLAGF
GYGLPISRLYARYFQGDLKLYSMEGVGSDAVIYLKALSSESFERLPVFNKSAWRHYKTTP
EADDWSNPSSEPRDASKYKANR
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atggacacattttccataatattcattcaaaatgtttccactgtccattatgaatttact
gctaaagctccaaacaagcctattcaagtagtctatgtaccttctcacttgtttcatatg
ttatttgaattattcaagaattcaatgagagctacagtggagttgcacgaaggtaagaga
gaaggatatccatcgatcaaaaccttagtcactttggggaaagaagatctatctattaag
ataagtgatcaaggtggaggtgtacctttaagaaaaatagacagattgtttaactacatg
tactcaacagcacccaggcctagtttggagcccacaagagctgttcctttggctggattt
ggctacggcttgccaatttctcgtctgtatgctaggtacttccaaggtgacctaaaactc
tactcaatggaaggtgttggatcagatgctgtaatttatttgaaggccctttcaagtgaa
tcatttgaaagacttcctgtttttaataagtcggcgtggcggcactacaagaccacacct
gaagcagatgactggagcaatcctagcagtgaaccaagggatgcttctaaatacaaagct
aaccgataa

DBGET integrated database retrieval system